KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_346222Help
Entry
ARALYDRAFT_346222 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00670  One carbon pool by folate
aly01100  Metabolic pathways
aly01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ARALYDRAFT_346222
Enzymes [BR:aly01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     ARALYDRAFT_346222
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 9316157
NCBI-ProteinID: XP_002880090
UniProt: D7LKW9
Position
Unknown
AA seq 355 aa AA seqDB search
MVQRYAISLGELVELPQIPHDIASRMQNVFCVEETHHYASNEAVKAYGLHLGIEMCINMF
RSLHLYTLNMENTTLAILMNLGMIDESKNFSFFTKEDVRPIFCANRPKSYISRTKGWEDF
PQGRWGDSRSASYGALSDHQFSRPRARDKKLEQEWVVPLKSVEDIQEKFKELCLGNLKSS
PWSELDGLQPETKIINEQLVKINSKGFLTINSQPSVNAERSDSPTVGWGGPVGYVYQKAY
LEFFCSKEKLDAVVEKCKALPSITYMSVNKGENWVSNTAQADVNAVTWGVFPAKEIIQPT
IVDPASFKVWKDEAFETWSRSWANLYQEADPSKICFCTFSLKYWDLVFTSVYHNK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggtccaacgttatgcgatatcacttggggagctggtggaactaccacagatcccgcac
gacatcgcttcgaggatgcaaaacgttttctgcgttgaggagactcatcattatgcgtcg
aatgaagctgtgaaagcctatggtcttcaccttgggatagagatgtgtataaatatgttc
aggtctcttcatctctacacattgaacatggagaacacaactcttgcaatattgatgaat
cttggtatgattgatgagtccaaaaatttctccttctttactaaggaagatgtgcgcccc
attttctgcgcaaaccgtccaaagagctacatttctagaaccaagggctgggaagacttc
ccacaaggccggtggggtgattcacgcagtgcttcatatggtgcactctcggatcatcag
ttctcacgtccacgagcacgtgacaagaagcttgaacaagaatgggttgtcccactgaaa
agtgttgaagatattcaggagaaattcaaggagctctgccttggaaaccttaaaagcagt
ccctggtctgaattagatggactccagccagagacaaagataataaacgagcaactggta
aaaatcaactccaaaggcttcttgaccatcaatagccaaccatcagtcaacgccgagaga
tctgattccccaactgttggatggggaggtcctgttggatatgtataccaaaaggcttat
ctagagttcttctgctcaaaggagaaattagatgcagtggtcgagaaatgcaaagctttg
ccatcgattacttacatgtctgtgaacaaaggagaaaactgggtatcgaacactgcccaa
gctgatgtgaatgctgttacttggggagttttcccggctaaggaaatcattcaaccaacc
attgtcgatcccgctagcttcaaagtctggaaggatgaagcatttgagacttggtcaaga
agctgggctaacttgtaccaagaagctgacccttccaagatttgcttttgtactttttct
ctaaaatattgggatttggtttttacatctgtctaccataacaaataa

DBGET integrated database retrieval system