KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_471085Help
Entry
ARALYDRAFT_471085 CDS       T01578                                 

Definition
(RefSeq) DNA polymerase delta subunit 4 family
  KO
K03505  DNA polymerase delta subunit 4
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00230  Purine metabolism
aly00240  Pyrimidine metabolism
aly01100  Metabolic pathways
aly03030  DNA replication
aly03410  Base excision repair
aly03420  Nucleotide excision repair
aly03430  Mismatch repair
aly03440  Homologous recombination
Module
aly_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ARALYDRAFT_471085
   00240 Pyrimidine metabolism
    ARALYDRAFT_471085
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ARALYDRAFT_471085
   03410 Base excision repair
    ARALYDRAFT_471085
   03420 Nucleotide excision repair
    ARALYDRAFT_471085
   03430 Mismatch repair
    ARALYDRAFT_471085
   03440 Homologous recombination
    ARALYDRAFT_471085
DNA replication proteins [BR:aly03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    ARALYDRAFT_471085
DNA repair and recombination proteins [BR:aly03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      ARALYDRAFT_471085
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     ARALYDRAFT_471085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_delta_4
Motif
Other DBs
NCBI-GeneID: 9325836
NCBI-ProteinID: XP_002889772
UniProt: D7KJU8
Position
Unknown
AA seq 122 aa AA seqDB search
MATKNLKGFYKQTKSNITGGISKSKPSSRKVTPKHAAAQGSDVIQPAALISHGSLDLNED
YDKEEEMLRQFDMNIAYGPCLGMTRLDRWERALRLGMNPPNEIEKLLKTGKVQQDCLWQG
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgaagaatttgaagggtttctacaagcagactaaaagcaatatcaccggaggt
atctccaagtccaagccttcttcacggaaagtcactcccaaacacgcggcggctcaaggt
tctgatgttatccagcccgccgcattgatttcacacggctccctcgatctcaatgaggat
tatgacaaggaggaggagatgcttagacaatttgacatgaacatcgcttatggtccttgc
ttgggtatgaccagacttgatcgatgggagcgtgcgctgcgtcttgggatgaatcctcct
aatgaaatcgagaagcttttgaaaactgggaaagttcagcaagattgtctgtggcaaggt
cgtgtctag

DBGET integrated database retrieval system