KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_474887Help
Entry
ARALYDRAFT_474887 CDS       T01578                                 

Definition
(RefSeq) short-chain dehydrogenase/reductase family protein
  KO
K11153  retinol dehydrogenase 12 [EC:1.1.1.300]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly01100  Metabolic pathways
Brite
Enzymes [BR:aly01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.300  NADP-retinol dehydrogenase
     ARALYDRAFT_474887
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase Phenol_Hydrox
Motif
Other DBs
NCBI-GeneID: 9323935
NCBI-ProteinID: XP_002887872
UniProt: D7KS78
Position
Unknown
AA seq 334 aa AA seqDB search
MIETVKHLIGSGGPSGFGSRSTADHVTCNSDLRSLTAIITGATSGIGAETARVLAKRGAR
LVLPARSVKTAEETKARILAEFPDAEIIVMHLDLSSLTSVRRFVDDFESLNLPLNILINN
AGKYAHKHAISEDGVEMTFATNYLGHFLLTKLLLKKMIETAAQTGVQGRIVNVTSVIHSW
FSGDMLQYLADISRNNRNYDATRAYALSKLANVLHTLELSRILHKMDANVTANCVHPGIV
RTRLTRDREGIVTDLVFFLTSKLLKSVPQAAATTCYVATSPRLRNVCGKYFSDCNEARTS
KFGSCNLKAQRLWTASDLLVSPPNSTPDLSQTSF
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgattgagacggttaaacacctgatcggctccggtggtcccagcggattcgggtcaaga
tccaccgccgatcatgtcacttgtaattctgatctccgttctctaactgccatcatcact
ggcgctacgtcggggataggagcggagacagcgcgtgttcttgctaagcgtggagctcga
cttgtgcttccggctcggagcgtcaaaaccgccgaggaaacaaaagctcgtatcctggcg
gagtttcctgatgcggagatcatcgttatgcatcttgatctcagctcacttacctctgtc
cgccgattcgtggacgatttcgaatctctcaatctcccactcaacatcctcataaacaat
gccgggaaatacgcgcataagcatgccatctctgaggacggtgtggagatgacctttgcc
actaattatctcggccattttctgctgacgaaactgctgttaaagaagatgattgaaacg
gcggcacaaaccggcgtgcaaggccgtatagtcaacgtcacgtccgtcatccatagctgg
ttttccggtgatatgttgcaatatctcgccgatatctcgcggaacaatagaaattacgat
gcgactcgagcctacgctctctccaagctcgccaacgtgctccacactcttgagctttcc
cggattctccataaaatggatgctaatgtgacggccaattgtgtccatcctggtatcgtg
agaacccgtctcacaagagatcgagaaggcatcgtcacagacttagtgtttttcttgacc
tccaagctattgaagtctgttcctcaggcagcagctacgacatgttacgtggcaacaagt
ccgagattgaggaacgtgtgtggcaagtacttctcagactgcaacgaagctaggacatct
aaattcgggtcttgcaatcttaaagctcagagactctggactgcttctgacttgttggtt
tctccacccaattccactcccgatctttctcaaacgtccttttaa

DBGET integrated database retrieval system