KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_475007Help
Entry
ARALYDRAFT_475007 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00480  Glutathione metabolism
aly00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ARALYDRAFT_475007
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ARALYDRAFT_475007
Enzymes [BR:aly01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ARALYDRAFT_475007
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 9322467
NCBI-ProteinID: XP_002887956
UniProt: D7KTH0
Position
Unknown
AA seq 167 aa AA seqDB search
MATKEPESVYEISIEDAKGNSLELSQYKDKVLLIVNVASKCGMTNSNYTELNELYSKYKD
KGLEILAFPCNQFGDEEPGTSDQITDFVCTRFKSEFPIFNKIEVNGDNASPLYKFLKKGK
WGIFGDDIQWNFAKFLVDKNGQAVERYYPTTSPITLEHDIKKLLNIS
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgaaggaaccagaatctgtttacgagattagcatcgaggatgctaagggaaac
agcttagaactcagtcaatacaaagacaaagttcttttgattgtcaatgttgcttccaaa
tgtgggatgacaaactcaaactacaccgaattgaatgagctttatagcaagtacaaagac
aaaggtctggagattctagcatttccttgtaaccagtttggtgacgaggaaccgggaact
agtgaccaaatcactgactttgtttgtactcgcttcaaatctgaattccccattttcaac
aagattgaagtaaacggagataatgcttctcctctgtataagttcttaaagaaaggcaaa
tggggaatcttcggcgatgacattcagtggaactttgctaagtttcttgttgacaagaac
ggtcaagctgtagaacgatattatccaactacttcccctattactcttgagcatgacata
aagaagcttctgaatatctcctga

DBGET integrated database retrieval system