KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_476541Help
Entry
ARALYDRAFT_476541 CDS       T01578                                 

Definition
(RefSeq) strictosidine synthase family protein
  KO
K01757  strictosidine synthase [EC:4.3.3.2]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00901  Indole alkaloid biosynthesis
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    ARALYDRAFT_476541
Enzymes [BR:aly01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.2  strictosidine synthase
     ARALYDRAFT_476541
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Str_synth SGL NHL Arylesterase LRR_2
Motif
Other DBs
NCBI-GeneID: 9325020
NCBI-ProteinID: XP_002888957
UniProt: D7KRP7
Position
Unknown
AA seq 326 aa AA seqDB search
MASFVFVISLLLLSLSSAVFSDDASFQKLPVPGKRSGPESFAFDSTGNGFYTGVSGGKIL
KYVPDKGYVDFAQITESSNSAWCNGALGTAFAGKCGRPAGIALNSKTGDLYVADAPLGLH
VIPPAGGLATKLADSVDGKPFKFLDGLDVDPTTGVVYFTSFSSKFGPREVLIAVGLKDAS
GKLFKYDPATKAVTELMQGLSGAAGCAVSSDGSFVVVSEFIKSNIKRYWIKGPKAGTIED
FSSLVSNPDNIRRVGSTGNFWVASVVNKVVMPTDPKAVKLDANGKVLQTIFLKNEFGNTL
LSEVNEFNGHLYIGTLTGPFAGVMKL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtttgtctttgtgatttctcttcttcttctctctctttcgtccgctgttttc
tccgatgacgcgtctttccagaaacttccggtgccgggaaagaggtcaggccctgaatct
ttcgcctttgattccaccggcaacggattctacaccggagtctccggtggtaaaatcctc
aagtacgttcccgacaagggttatgtcgattttgcccagatcacagaatcctcgaactcg
gcatggtgcaacggagcacttggaaccgctttcgcaggaaagtgcggtcgaccagcggga
atagccttaaacagcaaaacaggtgatctctatgtcgccgatgctccattgggtcttcat
gttatccctcccgccggaggtttggccacaaagctcgccgatagtgttgacggaaaaccc
ttcaagtttctagacggtcttgacgttgatcccactaccggcgtcgtctacttcacttcc
ttcagctccaagtttggtccccgcgaagtgttgatcgcagtgggattaaaagacgcgagt
ggaaagctcttcaaatacgacccagcgaccaaagcggtgactgagttaatgcaaggacta
agtggtgcggctggttgcgccgtgagctcagatggttcgttcgtggtggttagcgagttc
ataaagagtaacatcaagagatattggatcaaaggacccaaagctggaactattgaagac
ttctcaagtcttgtctcgaaccccgacaatatcaggagggtaggttctaccggaaatttc
tgggtcgcctcagtcgtgaacaaggttgtcatgcctaccgaccctaaggcggtcaaacta
gacgctaatggaaaagtgcttcagaccattttcctcaagaatgagtttgggaatactttg
cttagtgaagtcaacgagttcaacggccatctttacatcggaactcttactggacctttc
gccggagtcatgaaactttaa

DBGET integrated database retrieval system