KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_483948Help
Entry
ARALYDRAFT_483948 CDS       T01578                                 

Gene name
UXS2
Definition
(RefSeq) UDP-glucuronic acid decarboxylase 2
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00520  Amino sugar and nucleotide sugar metabolism
aly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ARALYDRAFT_483948 (UXS2)
Enzymes [BR:aly01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     ARALYDRAFT_483948 (UXS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short KR TrkA_N
Motif
Other DBs
NCBI-GeneID: 9316386
NCBI-ProteinID: XP_002882125
UniProt: D7LGQ2
Position
Unknown
AA seq 436 aa AA seqDB search
MASELTYRRHEMEQAEAESYYPKPIKPWFVAIRPIRYMLREQRLVFVLVGIAMATLGFTI
FSKPSNQPIPYDVDPLPGYGMRSYEKKASIEYMSRIGSAGGKIPLGLKRKVLRVVVTGGA
GFVGSHLVDRLMARGDNVIVVDNFFTGRKENVMHHFSNPNFEMIRHDVVEPILLEVDQIY
HLACPASPVHYKFNPVKTIISFTNVVGTLNMLGLAKRVGARFLLTSTSEVYGDPLQHPQV
ETYWGNVNPIGVRSCYDEGKRTAETLAMDYHRGANVEVRIARIFNTYGPRMCIDDGRVVS
NFVAQALRKEPLTVYGDGKQTRSFQFVSDLVEGLMRLMEGEHVGPFNLGNPGEFTMLELA
KVVQETIDPNAKIEFRPNTEDDPHKRKPDITKAKELLGWEPKVALRQGLPLMVKDFRQRV
FGDQKQASSTTSSSTE
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgagctgacataccggcgacacgagatggagcaagcagaagcggaatcttat
tatccgaagccgataaagccgtggttcgtagcgattcgtccgatccgttacatgctccga
gaacagagactcgtcttcgtcctcgtcggcattgccatggccacattaggattcacaatc
ttctccaaaccgtccaaccagccaattccgtacgacgtggatccgcttcccggatacgga
atgcgatcgtatgagaagaaggcgagcatcgagtacatgagccggatcggatcggcaggc
ggcaaaatcccgctaggcctgaaacggaaagtgctaagggtggttgtgacaggtggagca
ggattcgtcgggtcacacctggtggaccggttgatggcgagaggagataacgtgatcgtg
gtggacaatttcttcaccggaaggaaagagaacgtgatgcaccatttcagtaaccctaat
ttcgaaatgatccgacacgatgtagtggagccgatcctccttgaggttgatcagatctac
catttggcatgccctgcttctcctgtccactacaaattcaatcccgtcaagactatcata
tcctttacgaatgtggtgggaacattgaacatgttggggctagcgaagagagtgggagca
agattcttgctgacgagtacaagtgaggtctacggagatcctcttcaacatcctcaggtt
gagacttactggggcaacgttaatcccatcggtgttcggagttgttacgacgaaggcaaa
cgtaccgctgagactttggccatggactatcatagaggcgctaatgttgaggttaggatt
gctcggatcttcaatacttatggcccaaggatgtgtatcgatgacggtcgtgtggttagc
aacttcgttgcccaggcattaagaaaagagcctttgactgtttatggtgatggtaagcag
acaaggagtttccagtttgtctctgatctggtggagggtctgatgaggttgatggaggga
gaacatgtcggtccatttaaccttggtaaccccggtgaattcaccatgctcgagctcgct
aaggtggttcaagagacgattgacccgaacgcaaagatagagttcagaccaaacacagag
gacgacccacacaagaggaaaccagacatcacaaaggccaaagagcttcttggttgggaa
ccaaaggtggctctacgccaagggctcccacttatggtcaaagatttccgtcaacgtgtc
tttggcgaccaaaagcaggcatcctccaccacttcatcatcaacagagtaa

DBGET integrated database retrieval system