KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_485868Help
Entry
ARALYDRAFT_485868 CDS       T01578                                 

Definition
(RefSeq) alpha subunit of tryptophan synthase
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00260  Glycine, serine and threonine metabolism
aly00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
aly01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ARALYDRAFT_485868
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ARALYDRAFT_485868
Enzymes [BR:aly01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ARALYDRAFT_485868
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB ThiG NanE BtpA Ribul_P_3_epim
Motif
Other DBs
NCBI-GeneID: 9314060
NCBI-ProteinID: XP_002877992
UniProt: D7LUW2
Position
Unknown
AA seq 313 aa AA seqDB search
MAIAFKSGVFFLQSPKSQIGFRHASSSPDSSLSFKRFTPMASLSTSSPTLGLADTFTQLK
KQGKVAFIPYITAGDPDLSTTAEALKVLDACGSDIIELGVPYSDPLADGPVIQAAATRSL
ERGTNLDNILEMLDKVVPQISCPISLFTYYNPILKRGLGKFMSTIRAVGVQGLVVPDVPL
EETEMLRKEALNNDIELVLLTTPTTPTERMKRIVDVSEGFIYLVSSIGVTGARASVSGKV
QSLLKDIKEATDKPVAVGFGISKPEHVKQIAGWGADGVIVGSAMVKLLGDAKSPTEGLKE
LEKLTKSLKSALL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgctttcaaatccggcgtcttcttcctccaatccccaaaatcccaaattgga
ttccgccatgcttcttcttctcctgattcatcgctttctttcaagagattcactcccatg
gcttctctctccacctcttctcctactctcggtctcgctgatactttcacccagctcaaa
aaacaaggcaaagtagcattcataccgtatatcacagctggtgatccagatctctctact
actgctgaagcactgaaagttcttgatgcttgtggctctgacataatcgaattgggtgtt
ccttactctgatcctttagctgatggacctgttattcaggctgcggcaacgaggtcgttg
gagaggggaaccaacctcgataacatccttgagatgttggataaggttgttccacaaata
tcttgtccgatttcgttgttcacgtattacaacccgattcttaaacgtggattggggaag
ttcatgtctaccatcagagctgttggtgtacagggacttgtggttcccgatgttcctctt
gaggaaactgagatgctgagaaaagaagccctcaacaacgacattgagctggtcctactc
actacaccaactacaccaacagagagaatgaagcgaattgttgacgtgtcagaaggattt
atttaccttgtgagctcaattggagtgactggtgcacgagcatctgtaagcggaaaggtt
cagtcgctcttgaaggatatcaaagaggcgacagacaagccagtggcagtcggttttgga
atatcaaagccggagcatgtgaaacagatagctggatggggagcagatggagtgatcgta
ggcagtgcaatggtgaagctattgggggatgcaaagtcgccaacagaaggacttaaggag
cttgagaaactcaccaagtctctcaaatctgctcttctttga

DBGET integrated database retrieval system