KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_485941Help
Entry
ARALYDRAFT_485941 CDS       T01578                                 

Definition
(RefSeq) esterase/lipase/thioesterase family protein
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00561  Glycerolipid metabolism
aly01100  Metabolic pathways
Module
aly_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    ARALYDRAFT_485941
Enzymes [BR:aly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     ARALYDRAFT_485941
Peptidases [BR:aly01002]
 Serine Peptidases
  Family S33
   ARALYDRAFT_485941
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 Abhydrolase_2 DLH Esterase Peptidase_S15 AXE1 FSH1
Motif
Other DBs
NCBI-GeneID: 9314092
NCBI-ProteinID: XP_002876286
UniProt: D7LV17
Position
Unknown
AA seq 312 aa AA seqDB search
MVTYKEDYVSNSRGIQLFTCSWKPEEQQEPKALIFLCHGYAMESSITMSSTAMRLANAGF
AVYGMDYEGHGKSGGLNGYVKKFDDLVHDVYSHYSSICAREENKGKMRFLMGESMGGAVV
LLLERKKPDFWDGAVLVAPMCKLAEDIKPHPMVISFLTKLTRFIPTWKIVPSNDIIDVAF
KESHIRKQVRDNEYCYKGRPRLKTAHQLLLVSLDLEKNLDQVSMPFIVLHGEDDKVTDKN
VSKLLYEVASSSDKTFKLYPNMWHGLLYGESPENLEIVFSDIISWLNERASVTNQRLETE
LKQMDDGISMQK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggttacgtacaaagaggattatgtttcaaactcacgaggtattcaacttttcacgtgt
tcatggaaaccagaggagcagcaagaaccaaaggctttaatctttctctgtcatggctac
gccatggaatcaagcatcaccatgagcagcactgcaatgaggttggctaatgcgggcttc
gcggtctatggaatggactatgaagggcatggtaaatccgggggattaaatggttacgtc
aaaaaatttgatgatcttgttcatgacgtctattctcattactcctcaatttgtgcgagg
gaagagaataaggggaagatgaggtttctaatgggagaatccatgggaggagcagttgtg
ttactcttagagagaaagaagcctgatttttgggacggtgccgttttagtcgcccccatg
tgtaagttagcagaagacataaagccacatccaatggtgatctcatttctcacaaagcta
actcggtttattccaacttggaagatagttcctagcaacgatatcattgacgtagcattt
aaagaatcccacataagaaaacaggtaagggacaatgagtattgctacaagggccggcct
cgcttgaaaaccgctcatcaactcttactggttagcttggatcttgagaagaatcttgat
caggtatcgatgccatttattgtccttcacggtgaagatgataaagttactgacaaaaac
gtaagcaaactactatacgaggtggcttcaagttcggacaagactttcaagttatacccg
aacatgtggcatgggcttttatacggagaatctcctgagaatttggagattgtgttcagt
gatatcataagttggttaaacgagagagcttctgtcacaaaccaaaggttggagactgag
ttaaagcaaatggatgatggaatttctatgcaaaaataa

DBGET integrated database retrieval system