KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_486071Help
Entry
ARALYDRAFT_486071 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00052  Galactose metabolism
aly00561  Glycerolipid metabolism
aly00600  Sphingolipid metabolism
aly00603  Glycosphingolipid biosynthesis - globo and isoglobo series
aly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ARALYDRAFT_486071
  Lipid metabolism
   00561 Glycerolipid metabolism
    ARALYDRAFT_486071
   00600 Sphingolipid metabolism
    ARALYDRAFT_486071
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    ARALYDRAFT_486071
Enzymes [BR:aly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     ARALYDRAFT_486071
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Melibiase_2 Melibiase Melibiase_2_C
Motif
Other DBs
NCBI-GeneID: 9312429
NCBI-ProteinID: XP_002876361
UniProt: D7LVE6
Position
Unknown
AA seq 430 aa AA seqDB search
MKDSVLFLVGLFSLSVLVSQSISGRVKAPLLQSNTGGLVFSKSFNSIYDTSMYGRLQLNN
GLARTPQMGWNSWNFFACNINETVIKETADALLSSGLADLGYIHVNIDDCWSNLLRDSKG
QLVPHPETFPSGIKLLADYVHSKGLKLGIYSDAGVFTCQVRPGSLFHEVDDADIFASWGV
DYLKYDNCFNLGIKPIKRYPPMRDALNATGRSIFYSLCEWGVDDPALWAKEVGNSWRTTD
DINDTWASMTTIADLNNKWAAYAGPGGWNDPDMLEIGNGGMTYEEYRGHFSIWALMKAPL
LIGCDVRNMTAETFEILSNKEVIAVNQDPLGVQGRKIQANGEDDCQQVWSGPLSGDRIVV
ALWNRCSEQATITASWDVIGLESTISVSVRDLWQHKDVTENASGSFEAQVDAHDCHMYVL
TPQTVSHSDV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattcagtattgttcctcgttgggctcttctctttatctgttttggtctctcag
tcgatctcagggagagtcaaagctccattgttgcagagcaatactggtggattagttttc
agcaaatccttcaattcgatctatgatacttctatgtacggacgcttgcagctcaacaat
ggccttgctcgaactcctcaaatgggatggaatagctggaatttctttgcttgcaatatc
aatgaaacagtcataaaggaaactgctgatgctttactttcatctggattggctgatttg
ggatacatacatgtcaatattgatgattgttggtccaatttgttacgcgattcaaagggt
caattggttcctcatcctgaaaccttcccatcaggaattaagcttcttgctgattatgtt
cattcaaagggtctcaaactcggtatatattctgatgctggcgttttcacgtgtcaagtt
cgcccgggatcccttttccatgaagtggatgatgctgacatatttgcttcttggggtgtg
gattatctgaaatatgacaactgtttcaacctgggaataaaaccaatcaaaagataccct
ccaatgcgtgatgctctaaacgcaactggtcgctcaatcttctattcactttgtgaatgg
ggcgttgatgatccagccttgtgggcaaaagaagttggaaacagttggcgcacaaccgat
gacatcaacgatacatgggcaagtatgactacaattgctgatttgaataacaagtgggct
gcatatgctggacctggtggttggaatgatccggatatgttggaaattgggaatggaggg
atgacatacgaggagtatcgaggtcattttagcatttgggctttgatgaaggcacccctg
ttgattggttgtgatgtaagaaacatgaccgctgaaacttttgagattttgagtaataag
gaagttatcgctgtaaaccaagacccacttggtgttcaaggaaggaaaattcaagccaat
ggagaagatgattgtcagcaggtgtggtcaggacctttatctggtgaccgtattgtagtt
gctctctggaaccgttgctctgagcaagcaaccattacagcatcatgggatgtgattggt
cttgaatctaccattagcgtctcagtaagagatttgtggcagcacaaagatgttacagag
aacgcgtctggctcctttgaagctcaagtagacgcacacgactgtcatatgtacgttctc
actccccagacagtatcacactccgatgtatag

DBGET integrated database retrieval system