KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_487662Help
Entry
ARALYDRAFT_487662 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00020  Citrate cycle (TCA cycle)
aly00640  Propanoate metabolism
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
aly01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ARALYDRAFT_487662
   00640 Propanoate metabolism
    ARALYDRAFT_487662
Enzymes [BR:aly01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     ARALYDRAFT_487662
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ARALYDRAFT_487662
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 SseB
Motif
Other DBs
NCBI-GeneID: 9307386
NCBI-ProteinID: XP_002871316
UniProt: D7M1A4
Position
Unknown
AA seq 347 aa AA seqDB search
MSRQVARLIGSLSSKARRCSTGGSEVFPSCQSLTSLTQSRSFASDPHPPAAVFVDKNTRV
LCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKADTKANASVI
YVPAPFAAAAIMEGIEAELDLIVCITEGIPQHDMVRVKHALNSQSKTRLIGPNCPGIIKP
GECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD
CLEKFFVDPQTEGIVLIGEIGGTAEEDAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAG
AIVSGGKGTAQDKIKSLNDAGVKVVESPAKIGAAMYELFQERGLLKQ
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtctaggcaagtcgcaaggcttatcggatctctatcatcaaaagctcgccgttgttct
accggcggctcggaggtttttccgtcatgccagtctctcacttcgttgacccaatctcgc
tccttcgcgtcggatcctcatcctcctgcggcggttttcgttgacaaaaacacacgagtc
ctctgtcaaggcatcaccggaaagaacggcactttccacactgaacaagccattgagtac
ggcaccaaaatggtagcaggtgtgacaccgaagaagggtggaacagaacacttaggtctc
cctgttttcaactctgttgctgaagctaaggctgacaccaaagccaatgcctctgtgatt
tatgttcctgcaccttttgctgctgctgctattatggagggtattgaggctgagttagat
cttattgtgtgtattaccgaaggaatccctcaacatgacatggtacgtgtaaagcatgct
cttaacagtcaatcgaaaactaggctgattggtccaaactgccctgggattatcaaacct
ggtgaatgcaagattggaattatgccgggatacatccacaagcctgggaagatcggaatt
gtctcgcgatctggaaccttgacatatgaagctgttttccaaacaactgcagtgggtcta
ggccaatctacttgtgtaggaattggtggggatccttttaacgggacaaactttgtcgac
tgcttggagaaattctttgttgatcctcaaacagaaggtatcgttctcataggagaaatc
ggaggcactgctgaagaagatgctgcagcattgataaaggcaagtggtactgagaagcct
gttgttgcttttattgccggacttacggcaccaccgggtcgtcgaatgggtcatgcagga
gccattgtttctggtggtaaaggtacggctcaggacaaaattaagagtttgaatgatgcc
ggggtgaaggttgttgaatctccggctaagattggagcagcgatgtatgagctctttcaa
gaaagaggtcttttgaagcagtga

DBGET integrated database retrieval system