KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_488256Help
Entry
ARALYDRAFT_488256 CDS       T01578                                 

Definition
(RefSeq) HEMG2/MEE61
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00860  Porphyrin and chlorophyll metabolism
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
Module
aly_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ARALYDRAFT_488256
Enzymes [BR:aly01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     ARALYDRAFT_488256
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     ARALYDRAFT_488256
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 FAD_oxidored HI0933_like Thi4 Pyr_redox Pyr_redox_2 AlaDh_PNT_C IlvN Prenylcys_lyase FMO-like Pyr_redox_3 GIDA 3HCDH_N FAD_binding_3 NAD_binding_9 2-Hacid_dh_C NAD_binding_7 MCRA Shikimate_DH Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 9309724
NCBI-ProteinID: XP_002873656
UniProt: D7M615
Position
Unknown
AA seq 512 aa AA seqDB search
MESGAVGDHDTKFESISGKRVAVVGAGVSGLAAAYKLKSRGLNVTVFEADERAGGKLTSV
MQNGLIWDQGANTMTEAEPEVGSLLDDLGLRDKQQFPISQKKRYIVRNGLPMMLPTNPIE
LVTSSVLSTQAKIQILLEPFLWKKNDSSSKVSDASAEESVSGFFQRHFGQEVVDYLIDPF
VGGTSAADPDSLSMKHSFPDLWNVEKSFGSIIVGAIRTKLAAKGGKSGEAKSSPGTKRGS
RRSFSFKGGMQILPDMLCKSLSHDEINLDSKVLSLSYNSGSRQENWSLSCVSHNETQRQN
LHYDAVVMTAPLCNVKEMKVTKGGQPFLLNFLPEINYMPLSVLITTFTKEKVKRPLEGFG
VLIPSKEKKHGFKTLGTLFSSMMFPDRCPSDLHLYTTFIGGSRNQELAKASTDELKQVVT
SDLQRLLGVEGEPVSVNHYYWRKAFPLYDSSYGSVMEAIDKMEKDLPGFFYAGNHRGGLS
IGKSIASGCKAADLVISYLESCSNDKKPDESL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggagtctggagcagtaggtgatcatgatacaaaatttgaatcgatttccgggaaaaga
gtcgcagtcgtaggtgcaggtgtaagtggtctagcggcggcttacaaattgaaatcgagg
ggtttgaatgtgactgtgtttgaagctgatgaaagagcaggtgggaagttgacaagtgtt
atgcaaaatggcttgatttgggaccaaggagcaaacaccatgactgaggctgagccagaa
gttgggagtttgctcgatgatcttgggcttcgtgacaaacaacaatttccaatttcacag
aaaaagcggtatattgtgcggaatggtctgcctatgatgctacctaccaatcccatagag
ttggtcacaagtagtgtactctctacccaagctaagattcaaatcttgttggaaccattt
ctttggaagaaaaatgactcgtcctcaaaagtctcagatgcatctgctgaagaaagtgta
agtgggttctttcaacgccattttggacaagaggttgtggactatctcatcgaccctttt
gttggtggaacaagtgctgcggaccctgattccctttcaatgaagcattcttttccagat
ctctggaatgtagagaaaagttttggctctattatagtcggtgcaatcagaacaaagttg
gctgctaaagggggtaaaagtggagaagcaaagagttctcctggcacaaaaaggggttcg
cgcaggtcattctcttttaaggggggaatgcagattcttcctgatatgttgtgcaaaagt
ctctcacatgatgagatcaatttagactccaaggttctctctttgtcttacaattctgga
tcaagacaggagaactggtcactatcttgtgtttcacataatgaaacgcagagacaaaac
ctccattatgatgctgtagttatgacggctcctctgtgcaatgtgaaggaaatgaaggtt
acgaaaggagggcaaccctttctgctaaactttctccccgagattaattacatgcccctc
tcggttttaatcaccacattcacaaaggagaaagtaaagagacctcttgaaggctttggg
gtactcattccatctaaggagaaaaagcatggtttcaaaactctaggtacactgttctca
tcaatgatgtttccagatcgttgccctagtgaccttcatctatatacaacttttattggt
gggagtaggaaccaggaactggccaaagcttccacagacgaattaaaacaagttgtgact
tctgaccttcagcgactgttgggggttgaaggtgaacccgtgtctgtcaaccattactat
tggaggaaagcattcccgttgtatgacagcagctatggctcagtcatggaagcaattgac
aagatggagaaagatctacccgggttcttctacgcaggtaatcatcgaggcgggctctct
attgggaaatcaatagcatcaggttgcaaagcagctgatcttgtgatctcatacctggag
tcttgctcaaatgacaagaaaccagatgagagcttatga

DBGET integrated database retrieval system