KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_488460Help
Entry
ARALYDRAFT_488460 CDS       T01578                                 

Definition
(RefSeq) hydrolase, alpha/beta fold family protein
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00561  Glycerolipid metabolism
aly01100  Metabolic pathways
Module
aly_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    ARALYDRAFT_488460
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aly01002]
    ARALYDRAFT_488460
Enzymes [BR:aly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     ARALYDRAFT_488460
Peptidases [BR:aly01002]
 Serine Peptidases
  Family S33
   ARALYDRAFT_488460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Abhydrolase_2 Peptidase_S9 DLH FSH1 Esterase
Motif
Other DBs
NCBI-GeneID: 9309827
NCBI-ProteinID: XP_002871702
UniProt: D7M814
Position
Unknown
AA seq 351 aa AA seqDB search
MAPTATLDQNEELRRLKEVNIDEAPGRRRVRDSLKDIQLNLDHILFKTPENGIKTKESFE
VNSRGVEIFSKSWLPEASKPRALVCFCHGYGDTCTFFFEGIARRLALSGYGVFAMDYPGF
GLSEGLHGYIPSFDLLVQDVIEHYSNIKANPEFSSLPSFLFGQSMGGAVSLKIHLKQPNA
WTGAVLLAPMCKIADDLVPPPVLKQILIGLANVLPKHKLVPQKDLAEAGFRDIRKREMTP
YNMICYSGKPRLRTAVEMLRTTQDIEKQLQEVSLPILILHGEADTVTDPSVSRELYEKAK
SPDKKIILYENAYHSLLEGEPDDMILRVLSDIISWLDDHSLQAEGSLVTTM
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggctccgacggcgacgctggatcaaaatgaggagctccggcgactcaaggaggttaat
attgacgaagctccagggcgtcgtcgtgttcgtgattccttgaaagatattcagcttaat
ctcgatcatatcctcttcaagacaccagaaaatgggattaagacaaaggagtcttttgag
gtgaattcgagaggagttgagattttctctaaaagctggcttcctgaagcttctaagcct
agagctttggtttgtttctgccatggttatggagatacttgcacgtttttcttcgaaggg
attgctaggagattggcattgtcgggatatggagttttcgctatggattatccgggattt
ggcttgtcggagggcttgcacggttatatccctagctttgatcttcttgttcaagatgtc
attgagcattactccaacataaaagcgaatcctgagtttagttctctaccgagctttctc
tttggacagtcaatgggtggagctgtgtcactcaaaatacatctcaaacaaccaaatgca
tggaccggtgcagtcttgctagcaccaatgtgcaaaattgcagatgatttggttccacca
ccggtattaaaacagattttgatcggcctagccaatgttctaccgaaacacaagttggtt
ccacaaaaggatttagctgaagcagggtttagagatatcaggaagagggaaatgacacca
tacaacatgatttgttacagtggcaaaccaaggctacgcactgcagtagaaatgcttaga
acaactcaggacattgaaaaacaattgcaggaggtgtccttgccgatactgattctacat
ggagaagctgatacagtgacagatccttcagtgagcagagagctatacgagaaagcgaaa
agtccagacaagaagataattttgtatgaaaatgcgtatcattctctgctcgaaggcgaa
ccagacgacatgattctccgtgtcttgtccgatattatctcgtggctcgacgaccatagc
ttacaagctgagggatcattagttactactatgtag

DBGET integrated database retrieval system