KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_489433Help
Entry
ARALYDRAFT_489433 CDS       T01578                                 

Definition
(RefSeq) TIF3B1
  KO
K03253  translation initiation factor 3 subunit B
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly03013  RNA transport
Brite
KEGG Orthology (KO) [BR:aly00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ARALYDRAFT_489433
Messenger RNA biogenesis [BR:aly03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     ARALYDRAFT_489433
Translation factors [BR:aly03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    ARALYDRAFT_489433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF2A ANAPC4_WD40 IKI3 RRM_1 Proteasom_Rpn13 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 9310350
NCBI-ProteinID: XP_002874283
UniProt: D7M4L0
Position
Unknown
AA seq 739 aa AA seqDB search
MAAVVDIDALSAQLGVNWSEVNLDSIQLPPGNNFGIESDDEAVYHDDQSEFDTGFGNIIV
VDHLPVVPKEKFEKLEGVLKKIYNQLGVIKENGLWMPVDPDTKMTLGYCFIEFNTPQETE
LDCLTMVVYILRVCFNVWGSLQEAQNAKEKSHGYKLDKTHIFAVNMFDDFDRLMNVREEW
EPPQARPYVPGENLQKWLTDEKARDQLVIRSGPDTEVYWNDARQKKPEPVHKRPYWTESY
VQWSPLGTYLVTLHKQGAAVWGGADTFTRLMRYQHSMVKLVDFSPGERYLVTYHSQEPSN
PRDASKVEIKVFDVRTGRMMRDFKGSADEFSIGGPGGVAGASWPVFRWAGGKDDKYFAKL
SKNTISVYETETFSLIDKKSMKVDNVVDICWSPTDSILSLFVPEQGGGNQPAKVALVQIP
SKVELRQKNLFSVSDCKMYWQSSGEYLAVKVDRYTKTKKSTYSGFELFRIKERDIPIEVL
ELDNKNDKIIAFAWEPKGHRFAVIHGDQPRPDVSFYSMKTAQNTGRVSKLATLKAKQANA
LFWSPTGKYIILAGLKGFNGQLEFFNVDELETMATAEHFMATDIEWDPTGRYVATAVTSV
HEMENGFTIWSFNGNLVYRILKDHFFQLAWRPRPPSFLTAEKEEEIAKNLKKYSKKYEAE
DQDVSLLLSEQDREKRRALKEEWEKWVMQWKSLHEEEKLERQDLRDGEVSDVEEDEYEAK
EVEFEDLIDVTEEIVQESM
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtagttgatattgatgccctatcggctcagttaggggttaattggtctgag
gttaatctcgattcaatccaacttcctcctggaaacaactttgggatcgagagtgatgat
gaagctgtataccatgatgatcagtcagaattcgacactggatttggtaacattatcgtt
gttgatcacctccctgttgttcccaaggagaagtttgagaaactagaaggtgttctcaag
aaaatttataaccagttaggtgtgattaaggaaaatggactgtggatgcctgttgatccc
gatacgaagatgacattgggctactgttttattgagttcaatactcctcaggagacagaa
ctagattgtttgacaatggtagtgtatattctaagagtttgtttcaatgtctggggctct
ttgcaggaagcacaaaatgctaaggaaaagtcgcatggctacaagttggacaagactcac
atctttgctgttaacatgtttgatgatttcgataggttgatgaatgtgagggaggagtgg
gagcctcctcaggccaggccttatgtccctggggaaaatttgcagaagtggcttaccgat
gaaaaagcccgggaccagctagtcattcgttcaggccctgatactgaagtttactggaat
gatgccaggcagaagaagcctgaacctgttcataagcgtccttattggacagagagttat
gtgcagtggtctcctttaggtacataccttgtgacacttcacaagcagggggcagctgtt
tggggtggtgctgatacattcacgcgtctcatgcgttatcagcattctatggtcaaacta
gttgatttctcgccaggtgagagatatcttgtaacttaccatagccaagaaccaagcaat
ccgagagatgcaagtaaagtagagattaaggtctttgatgtgagaaccgggaggatgatg
agagatttcaagggtagtgctgatgagttttcaattggaggacctggtggtgttgctggt
gcctcttggcctgttttcagatgggctggtggaaaagatgataaatactttgccaagctt
agcaaaaacaccatctctgtctatgagactgagactttcagcctaatagacaagaaatcc
atgaaggttgataatgttgtggatatttgctggtctcccactgattccatcctttcattg
tttgttcctgaacaaggtggtggaaaccaacctgccaaggttgctctagtccaaatcccg
agcaaggtggagctgaggcagaagaatctcttcagtgtgagcgactgcaagatgtactgg
cagagtagtggagagtatcttgctgttaaggttgatcgatacacaaaaactaagaagagc
acatactctggatttgagcttttccgtatcaaagaaagggatattcccatcgaggttctt
gagctggataacaagaacgacaagatcattgctttcgcttgggagcccaagggtcacagg
tttgctgtgattcatggtgaccaaccaagaccagatgtcagtttctactcgatgaagacc
gcacaaaatactggaagggtttcaaagctcgcaacgttgaaggccaaacaagccaatgcc
ctcttctggtcgcccacaggaaagtacatcattcttgctgggttaaaaggtttcaatggc
cagcttgaatttttcaacgtggatgagctcgagacaatggccacagctgaacacttcatg
gccacggatatcgaatgggacccaactggaaggtacgttgcaaccgcagtgacatcagtc
cacgagatggagaatgggttcaccatatggtctttcaacgggaatttggtttaccggata
ctgaaggatcatttcttccagttggcttggcgtccaagaccgccatcattcttaactgca
gagaaggaagaagagatagcaaagaacctgaagaagtacagcaagaagtatgaggcagag
gatcaggacgtgtcgttgctgttgagtgaacaagacagagagaagagaagggcattgaag
gaagaatgggagaaatgggtgatgcagtggaagtctctgcatgaagaggagaaactcgag
aggcaagatcttcgagatggtgaagttagtgatgtggaagaagatgaatatgaagccaag
gaagttgagtttgaggatcttattgatgtcactgaggaaatcgttcaagagtcgatgtaa

DBGET integrated database retrieval system