KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_489590Help
Entry
ARALYDRAFT_489590 CDS       T01578                                 

Definition
(RefSeq) glutathione synthetase
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00270  Cysteine and methionine metabolism
aly00480  Glutathione metabolism
aly01100  Metabolic pathways
Module
aly_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ARALYDRAFT_489590
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ARALYDRAFT_489590
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aly04147]
    ARALYDRAFT_489590
Enzymes [BR:aly01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     ARALYDRAFT_489590
Exosome [BR:aly04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ARALYDRAFT_489590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSH_synth_ATP GSH_synthase
Motif
Other DBs
NCBI-GeneID: 9308343
NCBI-ProteinID: XP_002872274
UniProt: D7M652
Position
Unknown
AA seq 538 aa AA seqDB search
MGSGGGSVCSSLSYSSSSTCFASLFSICSPSSSSLKLNPRRFLFHNPTNLRKQAPLRCGR
SPEMESKKPIFDVETFDDDFVQKLVYDALVWSSLHGLVVGDKTYQKSGNVPGVGLMHAPI
SLLPTAFPEIYWKQACDVTPIFNELIDRVSLDGKFLQDSLSRTKKADVFTSRLLDIHSKM
LERNKKEDIRLGLHRLDYMLDEETNSLLQIEMNTISSSFPGLSRLVSQLHQSLLRSYGDQ
IGIDSERVPRNTSTIQFADAIAKAWLEYNNPRAVVMVTVQPEERNMYDQHLLSRNTHNIV
AIRKTLAEVETEGSVQEDGTLIVGGQAVAVVYFRSGYTPNDHPSESEWNARLLIEESSAV
KCPSIAYHLTGSKKIQQELAKPGVLERFLDNKEDIAKLRKCFAGLWSLDDPEIVKQAIEK
PGLFVMKPQREGGGNNIYGDDVRENLLRLQKEGEDGNAAYILMQRIFPKVSNMFLVREGV
YHKNQVISELGVYGAYLRNKDNVIVNEQSGYLMRTKIESSDEGGVAAGFAVLDSIYLN
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgggcagtgggggcggcagtgtctgctcttctctctcttactcttcttcttccacttgc
tttgcttctcttttctctatttgttctccttcatcttcttcgctgaaactcaatccaaga
cgcttccttttccataaccctacaaatctgagaaagcaggcacctttgaggtgtgggaga
tccccggagatggaatcaaagaaacccattttcgatgtggaaacgtttgatgatgacttt
gttcagaaactggtttatgatgctctcgtttggtcttctcttcacggactcgtcgtcggt
gacaaaacttaccagaaatcaggaaatgttccaggggttggattgatgcacgcaccgatt
tcattgctaccaactgcattccctgaaatttattggaagcaagcttgtgatgttactcct
attttcaatgaattgattgatcgtgttagcttggatgggaagttcttacaggatagtctc
tctagaacgaaaaaagctgacgtctttacatctagacttctcgacattcactccaagatg
cttgaaagaaacaagaaagaggacattcgtctgggtttgcatcggttggattatatgctt
gacgaagaaacaaattcacttcttcagattgagatgaacactatctctagttcgtttcca
ggccttagtcgtcttgttagccagctacaccagtcattgcttcgatcttatggggatcag
attggcatagactctgaacgtgtacctagaaatacatccacaatccaatttgctgatgca
atagctaaagcttggttggagtacaataacccaagagcggttgtcatggtaactgtacag
ccagaagaacgcaacatgtacgatcaacatttgctgagcaggaacacgcacaatatagta
gccatcaggaagactctagcagaagtcgaaactgaagggagtgtacaagaggatggaacc
cttattgttggcggccaagcagtcgcagttgtttatttcagatctggctatactcccaat
gatcatccgtctgaatcagaatggaatgctaggctgcttattgaggagtcttcagcggtc
aaatgcccgagtatagcttaccatttaactggcagcaagaaaatccagcaagaactggca
aaaccaggtgttctcgagaggtttctggacaacaaagaggacattgctaagctgaggaaa
tgctttgcggggctttggagcttggatgacccagaaatcgtcaagcaggcaatcgaaaaa
cccggactgtttgttatgaagcctcagagagaaggcggaggaaacaacatctatggagat
gatgtgagggaaaatcttttgagactgcagaaagaaggagaggacggaaacgctgcgtat
atcctgatgcagaggatattcccaaaggtctcaaacatgttcttggtgcgagaaggcgtt
taccataaaaatcaagttatatcagaactcggtgtctatggtgcttacctcaggaacaaa
gacaacgttatagttaacgagcagagtggttatctaatgcgcacaaagatcgagtcatca
gatgaaggcggcgttgccgctggttttgcagtattggacagcatttatctgaattga

DBGET integrated database retrieval system