KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_490107Help
Entry
ARALYDRAFT_490107 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
KEGG Orthology (KO) [BR:aly00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aly03016]
    ARALYDRAFT_490107
Enzymes [BR:aly01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     ARALYDRAFT_490107
Transfer RNA biogenesis [BR:aly03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    ARALYDRAFT_490107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TYW3 Met_10 Kelch_4 Kelch_6 Kelch_1 Kelch_3 Kelch_5 Kelch_2 MTS DNA_methylase Cons_hypoth95 GTSE1_N
Motif
Other DBs
NCBI-GeneID: 9310876
NCBI-ProteinID: XP_002872703
UniProt: D7M1S7
Position
Unknown
AA seq 996 aa AA seqDB search
MDFEKRKAATLASIRSSVTDKSPKGFLDEPIIPLLETINHHPSYFTTSSCSGRISILSQP
KPKSNDSTKKKARGGSWLYITHDPADSDLVISLLFPSKSNQIDPIDQPSELVFRFEPLII
AVECKDLGSAQFLVALAISAGFRESGITSCGDGKRVIIAIRCSIRMEVPLGDTEKLMVSP
EYVKFLVDIGNEKMDANRKRTDGFSVALTSNGFKNPDANDVDEDDNYENLAGDHDSSINN
GNLHPGLQQDLIPLSKLSIVGEPVEKLHLWGHSACTIDKPDRKEVIVFGGFGGFGRHARR
NESLLLDPSCGNLKLIAVNESPSARLGHTASMVGDFMFVIGGRADPLNILNDVWRLDISK
GEWSSQRCIGSEFPPRHRHAAASVGTKVYIFGGLYNDKIVSSLHILDTKDLQWKEVEQQG
QWPCARHSHAMVAYGSQLFMFGGYNGENVLNDLYSFDVQSCSWKLEVISGKWPPARFSHS
MFVYKHNTGIIGGCPVSQNCQELTLLDLKHRLWRSVRLEFMNKELFVRSTASVLGDDLIV
IGGGAACYAFGTKFSEPVKTNLVQSVTMSENNVPLQPEDVSIEWNKNDADLKTEMSLSQP
WVIQLERKYAKFGKDLLKSFGWLDLERKVYSNEKGLCICFPVTEKFSELFHEKQLLGKDL
EGSEDDSLEKGLSLKDISSSAALNLLKEHGAKKLINVAFEAKKVAKSPLQRMREYITSIL
KQKGLPEELLDELPQKWERLGDIVVLPATSFKDPTWNSISDEVWCAVSKSLSANRLARQG
RVEPNGTRDSTLEILVGDNGWVDHCENGILYSFDATKCMFSLGNLSEKLRMGNMACENEV
VVDLFAGIGYFVLPFLVRAKARLVYACEWNPHAIEALRRNVEANSVSDRCIILEGDNRIT
APKGVADRVNLGLIPSSEGSWVTAIQALRPEGGILHVHGNVKDSDESSWGEHVTKTLSDI
ARAEGRSWEVTVEHIEKVKWYAPRIRHLVADVRCRC
NT seq 2991 nt NT seq  +upstreamnt  +downstreamnt
atggatttcgagaagagaaaagctgcaacactagcttcaattcgttcgtcagtgactgac
aaatctcccaaaggttttctcgacgaacccatcatccctcttctcgaaaccatcaatcac
cacccatcttacttcactaccagttcctgctcaggtcgaatctcaatcctttctcaaccc
aaaccaaaatcgaatgattcaacgaagaagaaagctcgtggcggttcatggctctacatc
acacacgacccagctgattcggatttggtaatttctctgctttttccttcgaagtcaaat
cagattgacccaattgaccagcctagcgaattagtcttccgattcgagccgttgatcatt
gctgtcgaatgtaaggatttgggttcggctcagtttcttgtggcgttagctatatcagct
gggtttagagaatcgggtatcacatcttgtggggatggcaaaagggtaattattgctata
cgatgttcgattcgaatggaggtgcctcttggtgatacagagaagctgatggtttcgccg
gagtatgtgaagttccttgttgatattggaaatgagaagatggatgctaataggaagcga
accgatgggtttagtgtagctttgactagtaatggtttcaagaatccagatgcaaatgat
gttgatgaagatgataattacgagaatctagctggagatcatgattcaagtatcaacaac
ggaaacttgcatcctgggcttcagcaagatctcataccgctctcgaaattatccatagtc
ggggaacctgttgagaagctccacctttggggacactcagcttgtacgatagataaaccc
gaccgaaaagaggttatcgtgtttggtgggtttggaggttttggtagacatgctcgaaga
aatgagtctttgctgctcgatccttcatgtggcaacttaaagttgattgctgtcaatgaa
tctccatcagcacgacttggccacacagcttcaatggttggcgatttcatgtttgtgatt
ggaggaagggctgatcccttgaacattttgaatgatgtgtggaggctcgatatatccaag
ggtgaatggagctcacagaggtgtattggaagtgaatttcctccaaggcatcggcatgca
gcagccagtgttggcacgaaagtatacatatttggtgggctttacaatgataagatagtt
tcctctttgcacattttggatacaaaggacctgcagtggaaagaagttgaacaacaaggt
caatggccctgtgcgcgccactctcatgctatggttgcatatgggtcacagttattcatg
tttggaggatacaatggggaaaatgtactcaatgatctatacagctttgatgtgcaaagc
tgttcttggaaacttgaagtgatttctggaaaatggcctcctgcaaggttttcacactca
atgtttgtttataagcataatactggcataattggaggttgtcctgtttcacaaaattgt
caagagttgactttgctagatctgaagcaccgattgtggaggagtgtgagattggaattt
atgaacaaagagttgtttgttagaagtacagccagcgttcttggtgatgatcttatcgtc
attgggggtggggctgcttgctatgcttttgggacaaagtttagtgaaccagtgaaaacc
aacttggttcaatctgtgactatgagtgaaaataatgttcctctccaacctgaagatgtt
tctatagaatggaataaaaacgatgcagatttgaagactgaaatgtctctgtctcaacca
tgggtgatacagttagaaagaaaatatgcaaagtttggcaaggatctacttaaaagtttt
ggatggttagaccttgagaggaaggtttactcaaacgaaaaaggtctttgtatatgcttt
cctgtgactgaaaagttttctgaacttttccatgagaagcagcttttgggcaaggactta
gaagggtcagaggatgatagcctagaaaagggtctatccttaaaagacatatccagctca
gcggctttgaatcttctgaaggaacatggtgctaaaaaactcattaatgtcgcttttgaa
gccaaaaaagttgcgaaatcccccttacagagaatgagagaatatatcacatctatactt
aaacagaaaggcctaccggaagagcttttggacgagctcccacagaaatgggaacggctt
ggggatattgttgtgcttcctgcaacatcctttaaagatccaacttggaactctatcagt
gatgaagtttggtgtgcggtttctaaatcacttagtgccaaccgccttgcacgccaagga
cgagttgaacctaatggtacaagggatagtacattggagattcttgtgggagataatgga
tgggttgatcactgtgaaaatgggatcttgtactctttcgatgctacaaagtgtatgttc
tcattgggtaatctctcagaaaagcttcgtatgggtaacatggcctgtgaaaatgaagtt
gtggtggatctgttcgctggaattggatattttgttctcccatttcttgtgagggcaaaa
gcaaggctagtatatgcttgtgagtggaatccccatgctattgaagctcttcgacgtaat
gttgaagcaaattctgtttctgaccggtgtatcattcttgaaggggataaccggatcacc
gcaccgaaaggagtggctgacagagtcaatcttggtcttatcccgagtagcgaaggaagc
tgggtcacagctattcaggcattaaggcctgagggaggaatactccatgtgcatggaaac
gtcaaggactcagatgagagcagttggggcgagcatgtcaccaaaacattaagtgatatc
gccagagccgaaggtcgtagctgggaagtgacagtggaacatatagagaaggtgaaatgg
tacgctcctcggattcgccatcttgtcgccgatgtgagatgcagatgttga

DBGET integrated database retrieval system