KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_490161Help
Entry
ARALYDRAFT_490161 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K15014  solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
KEGG Orthology (KO) [BR:aly00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aly02000]
    ARALYDRAFT_490161
Transporters [BR:aly02000]
 Solute carrier family (SLC)
  SLC29: Facilitative nucleoside transporter
   ARALYDRAFT_490161
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nucleoside_tran
Motif
Other DBs
NCBI-GeneID: 9308806
NCBI-ProteinID: XP_002874832
UniProt: D7M1Y4
Position
Unknown
AA seq 418 aa AA seqDB search
MADIYEHQAPEKLQGKYQAMVVYCILGIGSLVSWNSMLSIADYYYQVFPDYHPSRVLTLV
YQPFALGTIVILAYHESKISTRKRNLIGYILYTISTFSLIVLDSATKGRGGIGPYIGLCA
VVASFGLADATVQGGMIGDLSLMCPELVQSFMGGLAVAGALTSALRLITKAAFEKTNNGL
RKGAMMFLAISTFIDLLCVMLYTYVLPKLPIVKYYRRKAASEGSKTVSADLAAAGIQNQS
GLTDDDSKNQRLSKKELLIQNIDYAVNLFLIYVCTLSIFPGFLYENTGHHGLGAWYALVL
VAMYNFWDLVGRYTPLVKWLKIENRKLITSAVLSRYLLIPAFYFTAKYGDQGWMIMLVSA
LGLTNGHLTVCIMTIAPKGYKGPEQNALGNLLVIFLLGGIFAGVALDWLWLIGKKNAF
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcggatatatacgagcaccaagctcctgagaagcttcaggggaagtatcaagcaatg
gttgtttactgtattcttggaattggatctctcgtttcttggaacagtatgcttagtata
gcagattactactaccaagttttcccggattatcatccttcaagggtactcacacttgta
taccaaccgtttgcgcttggaacaatcgtgattctcgcataccacgaatcgaaaatcagt
acccgaaaacgtaacctgatcggttacattctatacacaatatccacattctcactcata
gttttggattcggcaacaaaaggacgtggtggaatcggaccttatatcggtttatgcgca
gtcgttgcttctttcggcctcgcggatgctaccgttcaaggaggaatgataggtgattta
tcattgatgtgccctgaactagttcagtcattcatgggaggtttagctgtagctggtgcg
ctaacatcagcacttaggctaataactaaagcagcttttgagaaaacaaacaacggtcta
cgtaaaggagcaatgatgttcttagctatctccacattcatagatttactctgtgtgatg
ctatacacttatgtgttaccgaaactcccgattgttaagtattaccgaagaaaagccgct
tctgaaggatccaaaactgtttctgctgatcttgctgccgctggtatccaaaatcaatca
ggcttgactgatgatgattccaagaatcaaaggctaagcaaaaaggagctgttgattcaa
aacatagactatgcagtaaatttattcctcatctacgtttgtacattatctattttcccc
gggttcttgtatgaaaacacaggacatcacgggctaggcgcttggtatgcacttgtctta
gtagctatgtacaacttttgggatttggtcgggaggtacacgccgctggtgaaatggctc
aagattgagaatagaaaattaatcacaagtgcggttttgtcacgttatctcctcattccg
gcgttctacttcactgcaaaatatggtgatcaaggatggatgattatgctcgtttccgct
ttgggattaactaatggacatctcactgtttgcattatgactatagctcctaaaggatac
aagggtccggagcagaatgcgttagggaacttgctggtgatatttctgttaggagggata
tttgcgggagttgctttggattggttatggcttattggtaagaagaatgccttttga

DBGET integrated database retrieval system