KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_492423Help
Entry
ARALYDRAFT_492423 CDS       T01578                                 

Definition
(RefSeq) chloroplast heat shock protein 70-1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly03040  Spliceosome
aly04141  Protein processing in endoplasmic reticulum
aly04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:aly00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    ARALYDRAFT_492423
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    ARALYDRAFT_492423
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    ARALYDRAFT_492423
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aly01009]
    ARALYDRAFT_492423
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:aly03041]
    ARALYDRAFT_492423
   03009 Ribosome biogenesis [BR:aly03009]
    ARALYDRAFT_492423
   03110 Chaperones and folding catalysts [BR:aly03110]
    ARALYDRAFT_492423
   04131 Membrane trafficking [BR:aly04131]
    ARALYDRAFT_492423
   03051 Proteasome [BR:aly03051]
    ARALYDRAFT_492423
   03029 Mitochondrial biogenesis [BR:aly03029]
    ARALYDRAFT_492423
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aly04147]
    ARALYDRAFT_492423
Protein phosphatases and associated proteins [BR:aly01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     ARALYDRAFT_492423
Spliceosome [BR:aly03041]
 Complex B
  Other components
   Prp19 complex
    ARALYDRAFT_492423
 Complex C
   Prp19-CDC5 complex
    ARALYDRAFT_492423
Ribosome biogenesis [BR:aly03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    ARALYDRAFT_492423
Chaperones and folding catalysts [BR:aly03110]
 Heat shock proteins
  HSP70 / DNAK
   ARALYDRAFT_492423
Membrane trafficking [BR:aly04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    ARALYDRAFT_492423
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    ARALYDRAFT_492423
Proteasome [BR:aly03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    ARALYDRAFT_492423
Mitochondrial biogenesis [BR:aly03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    ARALYDRAFT_492423
Exosome [BR:aly04147]
 Exosomal proteins
  Proteins found in most exosomes
   ARALYDRAFT_492423
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FtsA FGGY_C StbA DUF5398
Motif
Other DBs
NCBI-GeneID: 9305798
NCBI-ProteinID: XP_002869727
UniProt: D7M8V6
Position
Unknown
AA seq 718 aa AA seqDB search
MASSAAQIHVLGGIGFASSSSSKRNLNGKGGTFMPRSAFFGTRTGPFSTPTSAFLRMGTR
NGGGASRYAVGPVRVVNEKVVGIDLGTTNSAVAAMEGGKPTIVTNAEGQRTTPSVVAYTK
SGDRLVGQIAKRQAVVNPENTFFSVKRFIGRKMNEVAEESKQVSYRVVRDENGNVKLECP
AINKQFAAEEISAQVLRKLVDDASRFLNDKVTKAVITVPAYFNDSQRTATKDAGRIAGLE
VLRIINEPTAASLAYGFDRKSNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGG
DDFDKRVVDWLATEFKKDEGIDLLKDKQALQRLTEAAEKAKIELSSLTQTNMSLPFITAT
ADGPKHIETTLTRAKFEELCSDLLDRVKTPVENSLRDAKLSFKDIDEVILVGGSTRIPAV
QELVRKVTGKEPNVTVNPDEVVALGAAVQAGVLAGDVSDIVLLDVTPLSIGLETLGGVMT
KIIPRNTTLPTSKSEVFSTAADGQTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGV
PQIEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPKDEVDQMVQEAERFAKDDKEK
RDAIDTKNQADSVVYQTEKQLKELGEKIPGEVKEKVEAKLQELKDKIGNGSTQEIKDAMA
ALNQEVMQIGQSLYNQPGAGAPGAGPSPGGEGASSADSSSSKGADGDDVIDADFTDSK
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggcatcttccgccgcccaaattcacgtccttggcggaattggattcgcttcttcttct
tcttccaagagaaaccttaatggtaaaggcggtacctttatgccgagaagtgccttcttc
ggtacaagaaccggtcctttctcaacacccacttctgcttttctcagaatgggcaccaga
aatggcggcggcgcttctagatatgcggttggtccggttcgtgtggttaacgagaaggtt
gttgggattgatttgggtacgactaactccgcagtagctgctatggaaggaggtaagcct
acgattgtgactaacgctgaaggtcagaggacgacgccttctgtggtggcttacacgaag
agtggtgataggcttgttgggcagattgcgaagaggcaagctgttgttaatcccgagaat
actttcttctccgtgaagaggtttattggtaggaagatgaatgaggttgctgaggagtct
aagcaggtttcttatagagttgttagagatgagaacgggaatgttaagcttgagtgtcct
gccattaacaaacaatttgctgctgaggagatttcagctcaggttttgaggaaacttgtg
gatgatgcctcaagattcttgaatgacaaagtaaccaaggctgtcattactgtacctgct
tacttcaacgactcacagaggacagctacaaaagatgctggtcgaattgctgggttggaa
gttcttcgtattatcaatgagcccacagctgcttcattggcctatgggtttgacagaaaa
agcaatgaaactatcctagtctttgatcttggtggtggtacctttgatgtctcagtgctt
gaggttggtgatggtgtgtttgaagtgctttccacttctggggacacacatttgggtggt
gatgacttcgacaagagagtggttgattggcttgctacagaattcaagaaagatgaaggg
atagatcttctgaaagacaagcaagcacttcagaggttaacagaggcagcagaaaaagct
aaaattgagctctcctcgctgactcagacaaatatgagcttgccatttatcaccgccaca
gccgatggacctaaacacatagaaaccaccctcacacgtgccaagttcgaagaattgtgt
tcagatttacttgacagggtcaagactcccgtcgaaaattctctgagggatgcaaagctc
agcttcaaagatattgatgaagttatccttgttggtggatccacacgtattcctgctgtt
caagaactcgtgaggaaggtgactgggaaagaacctaatgtcacagtaaatcctgatgag
gttgtagctttaggtgctgcagtccaggctggtgtgcttgccggagatgtgagcgacatt
gtgcttcttgatgtgacaccgctttccattggtttggagacccttggtggtgttatgact
aagattattccaaggaacactacactacctacttctaaatcagaagtcttttcaactgct
gctgatgggcagacaagtgttgagattaatgtgttgcagggtgagagggagtttgttcgg
gataacaagtctcttggtagcttccgtctagatggtattccaccggcaccacgtggagtt
ccacaaatcgaagttaaatttgacattgatgccaatggaattctatctgtcagtgctgtt
gacaagggcacaggaaagaagcaagacatcaccattactggcgcaagtacattgcccaag
gatgaggtagaccaaatggtccaggaagcagaaagatttgcaaaggatgacaaggagaag
agagatgcaatcgacacaaagaaccaggcagattcagtggtgtaccagacagagaagcag
ctgaaagaacttggagagaaaattccaggtgaagtgaaagagaaggtggaggctaagcta
caagagctgaaagacaagataggaaacggatcaacccaagaaatcaaagacgccatggct
gctcttaaccaagaagtgatgcagattggtcagtctctatacaaccagcctggagctgga
gctccgggtgcaggtccttccccgggaggcgaaggtgcttcatcagcagattcatcttca
agtaaaggagcagatggtgatgatgtgatcgatgctgacttcacagacagcaaatga

DBGET integrated database retrieval system