KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_492580Help
Entry
ARALYDRAFT_492580 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K05277  anthocyanidin synthase [EC:1.14.20.4]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00941  Flavonoid biosynthesis
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
Module
aly_M00138  Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    ARALYDRAFT_492580
Enzymes [BR:aly01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.20  With 2-oxoglutarate as one donor, and the other dehydrogenated
    1.14.20.4  anthocyanidin synthase
     ARALYDRAFT_492580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2OG-FeII_Oxy DIOX_N
Motif
Other DBs
NCBI-GeneID: 9305872
NCBI-ProteinID: XP_002867745
UniProt: D7MDZ4
Position
Unknown
AA seq 356 aa AA seqDB search
MVAVERVESLAKSGIISIPKEYIRPKEELESINDVFLEEKKEDGPQVPTIDLQNIESDDE
KIRETCIEELKKAALDWGVMHLINHGISVDLMERVKKAGEEFFGLSVEEKEKYANDQATG
KIQGYGSKLANNACGQLEWEDYFFHLVYPEDKRDLSLWPKTPSDYIEATSEYAKCLRLLA
TKVFKALSIGLGLEPDRLEKEVGGLEELLLQMKINYYPKCPQPELALGVEAHTDVSALTF
ILHNMVPGLQLFYEGKWVTAKCVPDSIVMHIGDTLEILSNGKYKSILHRGLVNKEKVRIS
WAVFCEPPKDKIVLKPLPETVSDESPAKFPPRTFAQHIEHKLFGKEQEELVSEKKN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggttgcggttgaaagagttgagagtttagcaaagagcggaatcatatcgattccaaaa
gagtacattcgtcccaaagaagagctagagagcatcaacgacgttttcctagaagagaag
aaagaagacggtcctcaagttcctacaatcgatctacaaaacatcgagtccgacgatgaa
aagatccgtgagacttgcatagaggaactgaaaaaggcagctttggattggggagtgatg
catttgatcaaccatggaatatctgttgatctaatggagcgggttaagaaagccggggaa
gagtttttcggtttgtccgtcgaagagaaggagaagtatgcgaatgatcaagccacagga
aaaattcaagggtatggaagtaagttggctaacaacgcttgcggacaattggaatgggaa
gattacttctttcatcttgtgtatcctgaagacaagagagatctatcactttggcctaag
acaccaagtgattacatagaagcaacgagtgagtacgcgaagtgtcttcgtttgttagca
acaaaagtcttcaaggctctctctatcggtctaggcttagagcctgaccgtctagagaaa
gaagttggtggtttagaagagcttcttctacaaatgaagataaattactatccaaaatgt
cctcagcctgagctagcactcggcgtggaagctcacaccgatgtaagcgctttaaccttc
attctacacaacatggttcccggtttgcagctattctacgagggaaaatgggtcactgca
aaatgtgttcctgattcgattgtgatgcacattggagatactttagagattcttagtaat
gggaagtataagagtatacttcatcgcgggttggtgaataaggagaaggttaggatttct
tgggctgtgttttgtgagccaccaaaggataagattgttcttaagccgttaccggagacg
gtgagtgatgagtctccggctaagtttcctccaaggacatttgctcaacatattgagcat
aagttgtttgggaaggaacaagaggaattggtatctgagaaaaagaattaa

DBGET integrated database retrieval system