KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_495082Help
Entry
ARALYDRAFT_495082 CDS       T01578                                 

Gene name
PIMT2
Definition
(RefSeq) protein-L-isoaspartate methyltransferase 2
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Enzymes [BR:aly01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     ARALYDRAFT_495082 (PIMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 PrmA Methyltransf_11 Methyltransf_32 Methyltransf_23 Methyltransf_3 Ubie_methyltran FtsJ
Motif
Other DBs
NCBI-GeneID: 9301854
NCBI-ProteinID: XP_002864046
UniProt: D7MQ37
Position
Unknown
AA seq 274 aa AA seqDB search
MRAQVLLFPTITAYGRLYCAPRRLHRYNSSSSSQFLNLSLSRFSGGLFFHMESGTSSSGK
KSMVENLKRYGVISSKRVAQVMEALDRGLFVPVGSSAYVDTPVPIGYNATISAPHMHATC
LQLLEDKLQPGMCALDVGSGTGYLTGCFALMVGAEGRVVGVDHIPELVDMSIKNIEKSVA
ASLLKKGSLSLHVGDGRKGWQEFAPYDAIHVGAAASEIPQPLLDQLKPGGRMVIPLGTYF
QELKVIDKNEDGSIKVHTETSVRYVPLTSRDEQL
NT seq 823 nt NT seq  +upstreamnt  +downstreamnt
atgagagctcaggttttattattcccaacaataacagcctatggtcgcctctattgtgcg
ccacgtagacttcaccgctacaattcatcatcatcatctcagtttctgaatctcagtctc
tctcgcttctccggtggtctcttcttccacatggagagtggaactagctcgagtggcaag
aaatcaatggtggaaaatttgaagcggtatggtgtgatatcatcgaagagagtagctcaa
gttatggaagctttagatagaggtctctttgtaccagttggatcttcagcttatgttgat
actcctgtacctataggttataatgctaccatttctgctccgcatatgcatgccacttgc
ttgcagcttttggaagataagctccagcccgggatgtgtgctttggatgttggttcagga
accgggtacttgactggctgttttgctttgatggttggagctgagggacgcgttgttggt
gtggatcatatccctgaattggttgatatgtctatcaagaatatcgaaaagagtgtcgct
gcttccttgcttaagaaaggatctctctccctacatgttggtgatggaagaaaaggttgg
caagagtttgcaccgtatgatgcaatacacgtaggagcagcggcatcagaaatcccgcag
cctcttttggatcagctaaaacccggtggacgaatggtgatcccactaggaacctatttt
caagagctcaaggtaattgataaaaacgaggatggttccatcaaggtacatactgaaact
tcggtcaggtatgtgcccctcactagccgcgacgaacagttag

DBGET integrated database retrieval system