KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_495839Help
Entry
ARALYDRAFT_495839 CDS       T01578                                 

Definition
(RefSeq) AP2/EREBP transcription factor
  KO
K09285  AP2-like factor, ANT lineage
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
KEGG Orthology (KO) [BR:aly00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aly03000]
    ARALYDRAFT_495839
Transcription factors [BR:aly03000]
 Eukaryotic type
  Other transcription factors
   AP2
    ARALYDRAFT_495839
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AP2
Motif
Other DBs
NCBI-GeneID: 9302277
NCBI-ProteinID: XP_002866203
UniProt: D7MN97
Position
Unknown
AA seq 548 aa AA seqDB search
MKNNNNKSSSSSSYDSSLSPSSSSSSHQNWLSFSLSNNNFNSSSNPNLTSSTSDHHHPHP
SHLSLFQAFSTSPVERQDGSPGVSTGDATAVLSIYPGGPKLENFLGGGATTTTTRSMQQV
QSLGGVVFSSDLQPPLHPPSAAEIYDSELKSIAASFLGNYSGGHSSEVSSVHKQQQNPLA
VSEASPTPKKNVESFGQRTSIYRGVTRHRWTGRYEAHLWDNSCRREGQSRKGRQGGYDKE
EKAARAYDLAALKYWGPTTTTNFPISNYESELEEMKHMTRQEFVASLRRSGFSRGASMYR
GVTRHHQHGRWQARIGRVAGNKDLYLGTFSTQEEAAEAYDIAAIKFRGLNAVTNFDISRY
DVKSIASCNLPVGGLMPKPSPATAAAEKTVDLSPSDTPSPTTPSLTFNVATTVHDHGGTF
YHTGIPIKPDPADHYWSSIFGFQANPKAEMRPIATFGSDLHNPSPGYAIMPVMQEGENNF
GGSFVGSEVYNNHSAHSSPVSAIPLSSTTNGNEGYGGNINWINNNISDSYQTAKSNLSVL
QTPVFGLE
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacaataacaacaaatcttcttcttcttctagctatgattcttctttgtctcct
tcttcttcatcttcctctcaccagaactggctctctttctctctctccaataacaacttc
aattcttcctcaaaccctaatctcacttcctctacatcagatcatcatcatcctcaccct
tctcatctctctctctttcaagctttctccacttctccagtcgaacggcaagatgggtca
ccgggagtttcaaccggcgatgccacggcggttctttccatttaccccggcggtcctaaa
cttgagaacttcctcggcggaggagccacaacgacgacaacaagatcaatgcaacaagtg
caatctctcggaggtgttgtcttctcttccgacctacagccaccgcttcatcctccctcc
gcggccgagatctacgactcggagctcaaatcaatagccgctagcttcctcggaaactac
tccggtggacactcgtcagaagtctctagcgttcataagcaacaacagaaccctctagct
gtctcagaggcttcgcccactccaaagaagaacgtagagagttttggacaacgtacttcg
atttatagaggagtcacaagacatcgatggactggaagatacgaagctcatctatgggat
aatagttgccgaagagaaggccaaagtagaaaaggaagacaaggtggttatgataaagaa
gagaaagcagctagagcttacgaccttgcagctcttaagtattggggtcctacaactacg
actaatttcccgatatcaaattacgagtctgaacttgaagagatgaaacacatgactcga
caagagttcgttgcttctctaagacgcagtggattctctaggggtgcctccatgtacaga
ggtgtcactagacatcatcagcatggtcgatggcaggcacgaattggaagagttgccggc
aacaaagacctttatcttggcacatttagcactcaagaggaggctgcagaagcttacgat
atagcagcgatcaaattccgcggtctaaatgcagtcaccaatttcgacatcagtcgatat
gacgtcaaatctatagctagctgtaatctccctgtgggtggactaatgcctaaaccgtct
ccagcaaccgcagcagctgagaaaaccgttgatttatctccatccgacactccatcaccg
acgacaccgtctctgaccttcaatgtggcaacaacggtccatgaccatggaggaactttt
taccacactggaataccaatcaaaccagacccggctgatcattattggtccagcatcttt
ggattccaggcaaacccgaaagccgagatgcgaccaatagcaacctttgggtcggatctt
cataacccctccccaggttatgctataatgccggtaatgcaagaaggcgaaaacaacttt
ggtggtagttttgttgggtctgaagtgtataacaatcattccgctcattcgagcccggtc
tcagcaattccgctgtcatcgacaacgaatggtaacgaagggtatggtggaaacattaac
tggattaataacaacatttcagattcttaccaaactgcaaagtctaatctctctgttttg
cagacaccagtttttgggttagaatga

DBGET integrated database retrieval system