KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_495950Help
Entry
ARALYDRAFT_495950 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
KEGG Orthology (KO) [BR:aly00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aly01001]
    ARALYDRAFT_495950
   01009 Protein phosphatases and associated proteins [BR:aly01009]
    ARALYDRAFT_495950
Enzymes [BR:aly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     ARALYDRAFT_495950
Protein kinases [BR:aly01001]
 Serine/threonine kinases: Other
  Wnk family
   ARALYDRAFT_495950
Protein phosphatases and associated proteins [BR:aly01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ARALYDRAFT_495950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pneumo_M2 Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 9300641
NCBI-ProteinID: XP_002864565
UniProt: D7MPN2
Position
Unknown
AA seq 571 aa AA seqDB search
MNMNQVAEYVETDPTGRYGRFAEILGRGAMKTVYKAIDEKLGIEVAWSQVKLKEVLRSSV
DLQRLYSEVHLLSTLNHKSIIRFYTSWIDVHNHTLNFITELFTSGTLRQYKNKYLRIDIR
AIKSWARQILEGLVYLHGHDPPVIHRDLKCDNIFVNGHLGQVKIGDLGLARMLRDCHSAH
SVIGTPEFMAPELYEENYNELIDVYSFGMCFLEMITSEFPYSECNNPAQIYKKVVAGKLP
GAFYRVGDIEAQRFIGKCLVSASKRVSAKELLQDPFLASDESWMVYASGAGNPKPFLNEN
EMDTLKLEDDELKTQMSIAGKLGAEDNKIDLEVQIAYDNGLANNVFFPFDIMNDTSIDVA
KEMVKELEIIDWEPVEIAKMIDGAISSLVPGWKYEEDDETPHDHHRNRTDPFHSSSSHSS
SSQASLSNYMARGLQDWGQDDLHDETYSQSSSHSGSYSNLNYIAVDEHSSQSPAMSRTHN
LTRFCPEESSHLQSGQANAYAASSSINRSLASDNRTLTRNRSLVDVQRQLLHRSPGEEAR
KRRLFKTVGDVETVGFQSPYAVSRKPPSSRR
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgaatcaagttgcagagtatgtcgaaactgatccaactggtcgctatggacgt
tttgcagaaattcttggaaggggagcgatgaagacagtgtacaaagcaatcgatgagaag
ctgggaatagaagtagcatggagccaggtgaagcttaaagaggttctgcgttcatctgtt
gatctacagaggctttactccgaggttcatctcctcagcactctcaaccacaaatctatc
attcgtttctacacttcctggattgatgttcataaccatactctcaacttcatcaccgag
ttgttcacttctgggaccctccgacaatacaaaaataagtacttgcggatagatatccga
gcaatcaagtcctgggctcggcaaatcttggaagggcttgtttatctccacggacacgac
cctcctgttatccatagagacctcaagtgtgataatatctttgttaatggccatcttgga
caagtcaaaattggtgatcttggtcttgcaagaatgctgcgggactgccattctgcacat
agtgtcatcggcactccggagttcatggctccagaattatatgaggagaactataatgag
ctcattgacgtttattcctttggtatgtgctttttggagatgatcacttctgagttcccg
tatagtgagtgcaacaatccggcgcaaatttacaagaaagttgtcgcgggaaagctacca
ggagccttttacagagttggagacatcgaggcacagaggttcatcgggaaatgcctcgtg
tctgcctcaaagagagtatcagcaaaagaactattgcaagatccatttcttgcctctgat
gagtcctggatggtgtacgcgagtggtgctgggaatccaaagcccttcttgaacgagaat
gaaatggacacactgaagttggaagatgatgagttaaagacacagatgtccatcgctggg
aagcttggcgctgaagataacaaaatcgatctggaagtacaaatcgcatatgataatggt
ctggcaaataatgtgttctttccctttgacatcatgaatgatacttccattgatgttgca
aaggagatggtaaaagaactcgagattatagattgggagccagtcgagattgctaaaatg
attgatggagcgatttcttctttggtgcctggttggaagtatgaggaagatgatgaaacc
cctcatgatcatcatcgtaatcgtaccgatcctttccactcttcttcctcgcactcgtca
tcttcccaagcttcactctctaactatatggcacgaggccttcaagattggggacaagat
gatttacacgatgagacgtattctcagagttcttcccattcagggtcttactccaacctc
aactacatagctgttgatgagcacagctcccaatctcctgctatgagcagaactcacaac
ttgacgaggttttgccccgaagaaagctctcatctgcagtcaggacaagccaacgcgtat
gcagcttccagttcaattaacagaagcttggcttcagacaaccgcacacttacaaggaac
cgatcacttgtagacgtgcagagacagttactgcaccggtcgccaggggaagaggctaga
aaaagaagattgttcaaaactgttggagacgtagaaacagttgggtttcagtcgccttat
gcggtttcacgtaagccaccaagctcaagacgctag

DBGET integrated database retrieval system