KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_496425Help
Entry
ARALYDRAFT_496425 CDS       T01578                                 

Gene name
ATGSTU9
Definition
(RefSeq) glutathione S-transferase tau 9
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00480  Glutathione metabolism
aly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ARALYDRAFT_496425 (ATGSTU9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aly02000]
    ARALYDRAFT_496425 (ATGSTU9)
Enzymes [BR:aly01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ARALYDRAFT_496425 (ATGSTU9)
Transporters [BR:aly02000]
 Other transporters
  Pores ion channels [TC:1]
   ARALYDRAFT_496425 (ATGSTU9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_N_4 GST_C Radical_SAM
Motif
Other DBs
NCBI-GeneID: 9302567
NCBI-ProteinID: XP_002866495
UniProt: D7MMB4
Position
Unknown
AA seq 234 aa AA seqDB search
MDEEIENKVILHGSYASPYSKRIELALKLKSIPYQFVQEDLQSKSQTLLRYNPVHKKIPV
LVHNGKPISESLFIIEYIDETWRNGPHLLPEDPYRRSKVRFWANYIQLHLYDVVIKVVKS
EGEEQERALTEVKEKLRVIEKEGLKEIFSDTDGEPTVTNETMSLVDIVMCTLLSPYKAHE
EVLGLKIIDPEIVPGVYGWINAINETRVVKDLSLPYEQVLEILRVFRQMSLSRS
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagaaattgagaacaaagtgattctccatggatcatacgcgagtccttacagc
aaaaggattgagttagcactcaagcttaaatccataccttaccaattcgtgcaagaagat
ctccagagcaagagccaaacccttctccggtacaatccggttcacaagaagatcccggtt
ctcgtccacaacggtaaacccatatctgaatccttatttatcattgagtacatcgacgaa
acgtggagaaacggaccacatcttttgccagaagacccttatagaagatctaaagtccgg
ttttgggctaactacatccaattacacctttacgatgtggtgataaaagtggtgaaaagc
gaaggagaagagcaagagagagctctcacagaggtgaaggagaagctgagagttatagag
aaagaagggcttaaggagattttctctgacactgatggtgaaccgaccgtgacaaacgag
accatgagcctcgtagacattgtgatgtgcactttgcttagcccttacaaggcacacgaa
gaagttttgggtctgaagattatagacccagagatagttcctggtgtctacggttggatc
aatgctattaacgaaaccagagtggtcaaagatctaagtcttccttatgaacaagtccta
gagattcttagggttttcagacagatgtctctctcccgttcctga

DBGET integrated database retrieval system