KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_496723Help
Entry
ARALYDRAFT_496723 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00250  Alanine, aspartate and glutamate metabolism
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ARALYDRAFT_496723
Enzymes [BR:aly01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     ARALYDRAFT_496723
Peptidases [BR:aly01002]
 Cysteine Peptidases
  Family C44
   ARALYDRAFT_496723
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase QueC
Motif
Other DBs
NCBI-GeneID: 9302719
NCBI-ProteinID: XP_002864935
UniProt: D7MSM2
Position
Unknown
AA seq 574 aa AA seqDB search
MCGILAVLGCIDNSQAKRSRIIELSRRLRHRGPDWSGLHCYEDCYLAHERLAIIDPTSGD
QPLYNEDKTVAVTVNGEIYNHKILREKLKSHQFRTGSDCEVIAHLYEEHGEEFIDMLDGM
FAFVLLDTRDKSFIAARDAIGITPLYIGWGLDGSVWFASEMKALSDDCEQFMSFPPGHIY
SSKQGGLRRWYNPPWYSEQVPSTPYDPLVLRNAFEKAVVKRLMTDVPFGVLLSGGLDSSL
VAAVALRHLEKSEAARQWGSQLHTFCIGLQGSPDLKAGREVADYLGTRHHEFQFTVQDGI
DAIEEVIYHIETYDVTTIRASTPMFLMSRKIKSLGVKMVLSGEGSDEILGGYLYFHKAPN
KKEFHEETCRKIKALHQFDCLRANKSTSAWGVEARVPFLDKEFLNVAMSIDPEWKMIKPD
LGRIEKWVLRNAFDDEQRPYLPKHILYRQKEQFSDGVGYSWIDGLKDHANKHVSDTMLSN
ASFVFPDNTPLTKEAYYYRTIFEKFFPKQSAARATVPGGPSIACSTAKAVEWDATWSKNL
DPSGRAALGVHVAAYEEDKAAAAAKVGSDSVDSP
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggattctcgctgttcttggttgcatcgacaactctcaagctaaacgttctcgt
atcatcgaactctctcgcagattgaggcatagaggccctgattggagtggactccattgt
tatgaagattgttatcttgctcatgagcgtttagccatcattgaccctacttctggagac
caacctctctataacgaagacaagaccgtcgctgtcacggtcaatggagagatatacaac
cataagattttgcgtgaaaagctaaagtctcatcaattccgtactggtagtgactgtgaa
gtgattgcacatctttatgaagaacatggagaggaatttatagatatgttggatggaatg
ttcgcgtttgtccttcttgatactcgcgacaaaagttttattgctgcaagggacgccatt
ggtatcactccactttacattggatggggtcttgatggttctgtctggtttgcttccgag
atgaaagctcttagtgatgattgtgaacagtttatgtcttttcctcctggccacatctac
tcaagtaaacaaggagggcttaggaggtggtacaatcctccgtggtactctgagcaggtt
ccttcaaccccatatgatcctttagttctgcgcaatgctttcgagaaggctgtagtaaag
agacttatgactgatgtgccttttggagttctcctatctggaggattggactcgtctctc
gttgctgcagtagcattacgccatttggaaaaatcggaagctgctcgtcaatggggttca
caattgcacacattttgcatcggattgcagggatcgccagatcttaaagctggcagagaa
gttgctgactatcttggaacacgccaccacgagtttcagtttactgttcaggatgggata
gatgcgatagaggaagtcatttaccatattgagacctatgacgtgactacaatcagagct
agcaccccaatgtttcttatgtccagaaaaattaaatctttaggtgtaaagatggttctt
tctggggaaggttctgatgaaattctcgggggatacttgtacttccataaggcgcccaac
aagaaagaatttcatgaagaaacatgccgaaagatcaaggctctccaccagtttgattgt
ttgagagctaataaatcaacttctgcgtggggtgtcgaagctcgtgtgccttttctagat
aaagaatttttgaatgtcgcaatgagcattgatccagagtggaagatgatcaagcctgat
ctcggaaggatcgagaagtgggtgctacgcaatgcctttgatgatgaacaacgaccttat
ctaccaaagcatattctgtatagacaaaaagaacagtttagtgatggcgttgggtatagc
tggattgatggtctaaaagatcatgcaaacaaacatgtctctgatactatgctgtcgaac
gccagctttgtcttccctgataacacacctctgacaaaagaagcttactactacagaacc
atcttcgaaaagttcttccctaagcagagtgctgcaagggcgacagtaccaggagggcca
agtatagcttgcagtaccgcgaaagctgtggaatgggatgcaacttggtcaaagaatctt
gatccgtcaggccgtgcggctcttggagttcatgttgcagcttatgaagaggataaagct
gctgctgctgctaaggttggatcagattcagtagattctccctaa

DBGET integrated database retrieval system