KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_669657Help
Entry
ARALYDRAFT_669657 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00601  Glycosphingolipid biosynthesis - lacto and neolacto series
aly00603  Glycosphingolipid biosynthesis - globo and isoglobo series
aly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    ARALYDRAFT_669657
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    ARALYDRAFT_669657
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aly01003]
    ARALYDRAFT_669657
Enzymes [BR:aly01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     ARALYDRAFT_669657
Glycosyltransferases [BR:aly01003]
 Glycan extension
  P blood group
   ARALYDRAFT_669657
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth TcdA_TcdB
Motif
Other DBs
NCBI-GeneID: 9315797
NCBI-ProteinID: XP_002881567
UniProt: D7LKT7
Position
Unknown
AA seq 750 aa AA seqDB search
MENDNCNKKSLSEVLDVRQFRHTNSPVFSTAIFGVIVLLVVAGTIVSNMSLESTFFWSSP
TSEVIQINKMERKSLAPPKNSTSRERIAWLRSHLTEFEIFGSTNLSEQFHQRVVDSLDDK
SEFFGKREILAVESVFKSHPQGCLMIVSGSLDSQQGDSILKPLIDRGYKVFAATPDISLL
LENTPAKSWFQEMKSCKRDPGKIPLQQNLSNLARLAILYKYGGVYLDTDFIVTRSFKGLK
NTIGAQTVVEGDSKNWTRLNNAVLIFEKDHPLVFSFIEEFASTFDGNKWGHNGPYLVTRV
AQRARETTGDNFTVLPPVAFYPFTWLNIPRLFQTPRSSNDSRILKTDLVKLNRESYGLHL
WNKITRKLKIESPNSTVSDNNPPFKPNVPLPRPYGPMSSSCNINSVLDSEYNEKELDPLV
PPRKASKNERIDWFRRKLPELEILKSTTKNKRFHKRVLDLYINNCSAQFFMIWLSPAKSF
GPREMLAVDTLFTTNPGACLAILSNSLDSPRGYTILKPLLDRGFNLIAVTLDIPFLVKNT
PAEAWLKRLKSGHMDPGSIPLFMNLSDLTRLAVLYKYGGVYLDTDIIFLNDMTGLRNAIG
AQSIDPGTKRWTRLNNAVMVFDIYHPLMREFLQEYATTFDGNRWGYNSPYLVSRVIKRLG
NKPGYNLTIFSPDAFYPVNWIKIQKLFKKPATTREAKWVEKTVQDMNKGSYMIHLWNKVT
RKIKIEEGSVMHTLISTHCTVCRNITNSHT
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atggagaatgataattgtaacaagaagagtctctcagaagtacttgatgtccggcaattc
aggcacacgaattccccggtattctctaccgccattttcggggtcatagtgctgctcgtt
gtcgcgggaacaatcgtctcaaacatgtcactagaatcaactttcttctggtcttcaccg
acctctgaggtaatacaaataaacaaaatggagagaaagtcattggctcctccaaagaac
agtacaagcagagagaggatcgcttggcttcgatcacatcttacagaattcgagattttt
gggtcaaccaacctttcagagcagtttcatcagagggttgttgactctctcgacgacaaa
tcagagtttttcgggaagagagaaattttggctgtagaaagcgtctttaaatctcatcct
caaggatgcttaatgattgtatcgggatccttggattctcaacaaggagatagcatccta
aaaccgctaattgatcgcggttacaaggtttttgcagccacaccagacatttcattgctt
cttgagaacaccccggctaaatcttggtttcaagaaatgaaaagctgcaaaagagatccg
ggaaagataccgttacagcagaatctttcaaacctcgcgaggctagcaattctttacaag
tacggaggtgtgtacctagataccgatttcatcgtcacaaggagctttaaagggttgaag
aatactattggcgcacaaacagtggtggaaggagattcaaagaactggacaaggttgaac
aacgcggttctgatcttcgagaaagatcacccgcttgttttcagtttcatagaggagttt
gcttcgacttttgatgggaacaaatggggacacaatggtccttacttggtaaccagagta
gcgcaaagagcacgagaaacgactggggacaatttcacagtactgccaccagtagcattc
tatccattcacttggttaaacattccaagactgtttcaaacgccaaggagcagcaatgac
tcgagaatactcaaaaccgatctggtgaagctgaacagagaaagctatgggctgcatcta
tggaacaagatcaccagaaaacttaagatcgaatctccgaactctactgtctctgataat
aacccaccgttcaaaccaaacgtgcctcttcccagaccctatggccccatgagtagtagc
tgtaatatcaactcagttttggactcggagtataacgaaaaggagttagatccgttggtg
cctcctcgtaaagctagcaagaacgagagaattgactggttcagaagaaagctacctgag
ctggagatactgaaatcgactaccaagaacaagagattccataaaagagttttggacttg
tacatcaacaattgctcagctcagttctttatgatctggctttctcccgcaaaatccttt
ggaccaagagagatgttagctgttgatactctcttcaccaccaatcctggtgcttgcttg
gcgattttgtccaactccttagactcccccagaggatacaccatccttaaaccattgctt
gatcgaggtttcaacctcattgctgtaactttagatatcccgttcctcgtcaagaacact
cctgccgaggcttggctgaaaaggctaaagagtggccacatggatcccggttctatcccc
ttgtttatgaatctctctgatctaacaagactcgcggtactctacaaatacggaggagtc
tatctagacacagacatcatcttccttaacgatatgacaggactgagaaacgctattggt
gcacagagtattgatccaggaaccaagagatggacaagactaaacaacgcagtgatggtc
tttgacatctaccatccgcttatgcgagaattcttgcaagagtatgccacaacattcgac
ggaaacagatggggatacaacagcccttacctagtctctagagttatcaagagattagga
aacaaacctggatacaacctcacaatcttttcccccgacgctttctatccagtgaattgg
atcaaaatccaaaagcttttcaagaaacctgcaaccacaagagaagcaaaatgggtagag
aagacggtacaggatatgaacaaagggagttacatgatacatctgtggaacaaagtcaca
aggaagattaagattgaagaaggaagtgtaatgcacactctcatctccactcattgcaca
gtctgcagaaacatcacaaattcccacacttaa

DBGET integrated database retrieval system