KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_674863Help
Entry
ARALYDRAFT_674863 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
KEGG Orthology (KO) [BR:aly00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aly01001]
    ARALYDRAFT_674863
   01009 Protein phosphatases and associated proteins [BR:aly01009]
    ARALYDRAFT_674863
Enzymes [BR:aly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     ARALYDRAFT_674863
Protein kinases [BR:aly01001]
 Serine/threonine kinases: Other
  Wnk family
   ARALYDRAFT_674863
Protein phosphatases and associated proteins [BR:aly01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ARALYDRAFT_674863
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr bHLH-MYC_N OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 9322400
NCBI-ProteinID: XP_002887869
UniProt: D7KS73
Position
Unknown
AA seq 1083 aa AA seqDB search
MNVLLFSFVHLDDFRLLRFEEAYNDEQSVALVDDMILQAHILGQGYAFTLHSNIYYLSLC
LCLCIYFSFDEFRIVGEVASTGNHQWLFSDALFQKNKDLIFMCLIVLQWDHEFQNQFLSG
FKILIRQFPYTQTIAILPLGSSGVVQLGSTQKILESSEILEQTTRALQETCFKPDDSGDL
DTLFESLVPLGDCEIFPAESFQGFSFDDIFADDNPPSLLSPEMISVETSEAASSHQDLSN
GDDFGFDILESYSLDDLYQLLADSPEQNCSSMVIQGDDKDLFDILGMNPQTPTMALPPKG
LFSELISSSLSNNTCSSSLTNVQDYSGVNQSKRRKLETSSEHSSSLFPQEETVNGRSLWN
DDERSSVGGNWKKPHEEGVKKKRAKAGESRRPRPKDRQMIQDRIKELRGMIPNGAKCSID
TLLDLTIKHMVFMQSIAKYADRLKEPYEPKLVKEKERTWALEVGEGGVVCPIMVEELNRK
GEMQIEMVCDERDEFLEIGDVVRGLGLKIVKGVMERRKGQTWAQFIVEAKPQVTRIQVLY
SLTTQRHLSTVIVWEMAATLLCSRCRFRSAISTPTASPVRPSPIQSPSTSSSPCNPLYQP
SLLLFFSSLVVVKIRYKAFDEVQGIEVAWNLMSIEDVLQMPGQLDRLYSQVHLLNSLKHD
NIIKLFYSWVDDHNKSINMITELFTSGLHFLHSQTPPVIHRDLKCDNIFVNGHTGEVKIG
DLGLAAVMQQPTARSVIGTPEFMAPELYEEEYNELVDIYSFGMCMLEMVTCEYPYNECRN
QAQIYKKVTSGIKPQSLSKVDDPQVKQFIEKCLLPAPSRPTALELLKDQLLAVDGAKDST
LAASSNTTFKPAKPPHSEYRRMDVDHKENTSVSICSSAKSSQECAWLQTIEVQRVAENTE
FRLSGERRDDVAASMALRIAGSSGQARKVDFDFNLKTDTARAVTGEMVEELDLSSQEVIV
IAEMIDELIMKLKANRSLPYDANSLYQSKDEEAGESMKSDISADYYHRVSSNEGSGLGCC
CEAVESLLSSFLDSCSMVSNKQSDDLKAELNVIESQYKQSCQRLLKLKEEAIEKAKRKWM
KLS
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgttgttatttagttttgttcatttggatgatttcaggctattgagatttgaa
gaagcatacaatgatgaacaatcagtcgccctagttgatgatatgattctacaggctcat
atcttaggccaagggtacgcttttactcttcactcaaatatatattatctgtctctgtgt
ttgtgtttatgtatatacttttcttttgatgaatttagaattgtgggcgaagtagcttcg
accggtaaccatcaatggctgttctcagacgcattgtttcagaagaataaagatttgata
tttatgtgtttgattgttttgcagtgggaccatgagtttcagaatcagtttctctctggc
tttaagattcttattcggcagtttccttatacacagactatagcaatccttccactagga
tccagcggcgttgttcagctaggatctactcaaaagattcttgagagctcagagatattg
gaacaaacaacaagagctctgcaggagacgtgtttcaaaccagatgattcgggggatctc
gatactctgttcgagtctttagtcccactgggagattgcgagattttcccagctgaatct
ttccaaggattcagctttgacgacatcttcgctgacgacaatcctccttctttgctcagc
cctgagatgatctctgttgaaacctctgaagcagcttcttcccaccaagatcttagcaat
ggagatgattttgggttcgacattctcgagtcttactctctggacgatctttaccagctg
ctagctgattcccctgaacagaactgctcttccatggtgatccaaggagatgacaaggat
cttttcgacattttggggatgaatcctcaaacgcctacaatggctttgccgcctaaagga
ctcttctcagagctcataagcagtagtcttagcaacaacacttgtagtagttctctcaca
aacgtgcaagactattctggcgtgaaccagagcaaaagacggaagcttgaaacatcatca
gagcatagctcaagcttgtttccgcaggaggagacagtaaatggtcggagtttgtggaat
gatgatgagagatcgagcgttggagggaattggaagaagcctcacgaagaaggtgtgaag
aagaaaagagcaaaggcaggagaaagcaggaggccgaggcctaaggaccgtcagatgata
caagaccgtatcaaggagctgcgagggatgattccaaatggagctaagtgtagcatagat
acgttgcttgatctgaccataaaacacatggtgttcatgcaaagcatcgccaagtacgcg
gacagactcaaagaaccatacgagcctaagctggtgaaggagaaagagagaacatgggcg
ttggaagtgggggaaggaggagtggtatgtccgataatggtggaggaactgaacaggaaa
ggagaaatgcagatagagatggtgtgtgatgaaagagatgagtttctggagataggagac
gtggtgagaggattgggattgaagatagtgaaaggagtgatggaaagaagaaaagggcaa
acatgggcacagttcatcgtagaggcaaagccacaagtgacaaggattcaagtcttgtac
tcacttacgacgcagaggcacctcagcaccgtcatcgtctgggagatggccgccacactc
ctctgttcccgatgtcggttccgatcggcgatatcgactcctactgcttcgcccgtgagg
ccttctccgatccaatctccttccacctcctcctcaccctgtaaccccctctaccaacca
tccctccttttgtttttctcatctcttgttgttgttaaaatcagatataaggcatttgat
gaagtccaaggtattgaagttgcttggaacctcatgagcattgaagatgtcttgcagatg
cctggccaacttgataggctatattcccaagtccatctcctcaattcccttaaacatgat
aacatcatcaaactcttctactcttgggttgatgatcataacaagtccatcaacatgatc
actgagcttttcacctctggcctccactttttgcattctcagacccctcctgtaattcac
cgggaccttaagtgtgacaatatttttgtcaacggacataccggagaggtcaaaatcgga
gatcttggccttgcagctgttatgcaacaacccactgctcgaagtgtgataggtactcct
gaattcatggcgcctgagctctatgaagaagaatacaatgaacttgtggacatctattct
tttggcatgtgcatgttggagatggtaacatgtgaatatccatataatgaatgcagaaac
caggctcaaatatacaagaaggttacctcgggtataaaacctcaatctctcagcaaagtt
gatgatcctcaagttaagcaattcatagagaagtgtcttctcccagctccttctagacca
actgctctagagctcctgaaggaccaactccttgcagtagatggcgccaaggactccact
cttgctgcttcatcaaacacaacattcaaacctgcaaagccaccacactctgaatatcgt
cgtatggatgttgatcataaggagaatacaagtgtttccatctgctcctctgctaaaagc
agccaagaatgtgcatggctccagaccattgaagtccagagggttgctgaaaataccgaa
ttcaggttgagtggagagaggagagatgatgtggcagcatcaatggctctgcgtatcgcg
ggctcatctggtcaagcaagaaaagtcgattttgacttcaatctgaagacagacacagca
agagcagttacaggggagatggttgaagagcttgatctgtcaagtcaagaggttattgtg
atagctgagatgatagatgaactgataatgaagctgaaggctaatcgaagcctgccttat
gatgcaaacagtttatatcagtcgaaggatgaagaagctggagaatcaatgaagtcagac
atatcagcagactactaccatcgggtctcctcaaacgagggttcagggctcggctgctgc
tgcgaggcagtagagtctttgttgtcctcgtttctggattcatgctcaatggtgtcaaac
aagcagtcggatgatctgaaggcggagctgaatgtgatagagtcgcaatataagcaatct
tgtcaacgactgctgaagctgaaagaggaagctatagagaaggctaaacggaagtggatg
aagctgagttga

DBGET integrated database retrieval system