KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_675829Help
Entry
ARALYDRAFT_675829 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00630  Glyoxylate and dicarboxylate metabolism
aly00710  Carbon fixation in photosynthetic organisms
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
aly01200  Carbon metabolism
Module
aly_M00165  Reductive pentose phosphate cycle (Calvin cycle)
aly_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
aly_M00532  Photorespiration
aly_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ARALYDRAFT_675829
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    ARALYDRAFT_675829
Enzymes [BR:aly01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     ARALYDRAFT_675829
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 9324421
NCBI-ProteinID: XP_002888358
UniProt: D7KRD9
Position
Unknown
AA seq 479 aa AA seqDB search
MSPQTETKASVGFKAGVKEYKLTYYTPEYETKDTDILAAFQVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHFEPVPGEETQFIAYVAYPLDLFEEGLVTNMFTSI
VGNVFGFKALAALRLEDLRIPPAYTKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKSQAETGEIKGHYL
NATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLTKALRLSGGDHVHAGTVVGKLEGDRESTLGFVDLLRDDYVEKDRSR
GIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAVEGNEIIREACKWSPELAAACEVWKEIRFNFPTVDKLDGQE
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagagactaaagcaagtgttggattcaaagctggtgttaaagagtat
aaattgacttattatactcctgaatatgaaaccaaggatactgatatcttggcagcattc
caagtaactcctcaacctggagttccacctgaagaagcaggggctgcggtagctgctgaa
tcttctactggtacatggacaactgtatggaccgatgggcttaccagccttgatcgttac
aaaggacgatgctaccacttcgagcccgttccaggagaagaaactcaatttattgcgtat
gtagcttaccccttagacctttttgaagaaggtttggttactaacatgtttacctcgatt
gtgggtaatgtatttgggttcaaagccctggctgctctacgtctagaggatctgcgaatc
cctcctgcttatactaaaactttccaaggaccacctcatggtatccaagttgaaagagat
aaattgaacaagtatggacgtcccctattaggatgtactattaaaccaaaattggggtta
tccgcgaagaactatggtagagcagtttatgaatgtctacgtggtggacttgattttacc
aaagatgatgagaatgtgaactcccaaccatttatgcgttggagagaccgtttcttattt
tgtgccgaagctatttataaatcacaggctgaaacaggtgaaatcaaagggcattatttg
aatgctactgcgggtacatgcgaagaaatgatcaaaagagctgtatttgccagagaattg
ggagttcctatcgtaatgcatgactacttaacagggggattcaccgcaaatactagtttg
gctcattattgccgagataatggcctacttcttcacatccaccgtgcaatgcacgctgtt
attgatagacagaagaatcatggtatgcacttccgtgtactaactaaagctttacgtcta
tctggtggagatcatgttcacgcgggtacagtagtaggtaaacttgaaggagacagggag
tcaactttgggctttgttgatttactgcgcgatgattatgttgaaaaagatcgaagccgc
ggtatctttttcactcaagattgggtctcactaccaggtgttctgcctgtggcttcaggg
ggtattcacgtttggcatatgcctgctttgaccgagatctttggagatgattctgtacta
caattcggtggaggaactttaggccacccttggggaaatgcaccgggtgccgtagctaac
cgagtagctctggaagcatgtgtacaagctcgtaatgagggacgtgatcttgcagtcgag
ggtaatgaaattatccgtgaagcttgcaagtggagtcctgaactagctgctgcttgtgaa
gtatggaaagagatcagatttaacttcccaaccgtcgataaattagatggccaagagtag

DBGET integrated database retrieval system