KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_887802Help
Entry
ARALYDRAFT_887802 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase DUF2611
Motif
Other DBs
NCBI-GeneID: 9328382
NCBI-ProteinID: XP_002889584
UniProt: D7KFA7
Position
Unknown
AA seq 305 aa AA seqDB search
MSLSASEKEENHRKMAADKAEMGRKKRALWERKWKRLDIVKAFASLFVHFLCLLAPFNFT
WPALRVALIVYTVGGLGITVSYHRNLAHRSFKVPKWLEYFFAYCGLLAIQGDPIDWVSTH
RYHHQFTDSDRDPHSPNEGFWFSHLLWLFDTGYLVEKCGRRTNVEDLKRQWYYKFLQRTV
LYHILAFGFLLYYFGGLSFLTWGMGIGVAMEHHVTCLINSLCHVWGSRTWKTNDTSRNVW
WLSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLATDVKLPSESQRRR
MAMVR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgtcagcctcagagaaggaggagaaccatcggaaaatggctgcggacaaggct
gagatggggaggaagaagagggcattgtgggaaagaaagtggaagagattggacattgtg
aaagcttttgcttctctctttgtgcatttcctctgtctcttggctcctttcaatttcact
tggccggctttaagagtcgccctcattgtctatacggtgggtgggctcggtatcaccgtc
tcttaccaccgaaatttggctcaccggagcttcaaagtccctaaatggctcgagtatttc
ttcgcctattgtggccttctcgccattcagggagatccgattgattgggtgagcacacat
cgataccatcaccagtttacagattcggatagggacccacatagtcctaatgaaggattt
tggttcagtcacctcctatggctatttgataccggttatcttgtagaaaagtgtggaaga
aggacaaatgtggaggacttaaagaggcagtggtactataaattccttcaaagaacagtc
ctttaccacattctagcatttggtttcctcctctattactttggtggtttgtcttttctt
acttggggaatgggtattggggtagcaatggagcatcatgtgacttgcctcatcaactct
ctttgccatgtttggggaagccgaacttggaagactaatgacacttcccgtaacgtttgg
tggctatcagtattttcgtttggagagagctggcacaacaatcaccacgccttcgaatcc
tcggcgagacaaggcttggaatggtggcaaatcgacatttcttggtatattgtccgcttt
ctcgagattatcggtttagctactgatgtcaagttgccttccgagagtcaacgacgtcgt
atggcaatggttcgttga

DBGET integrated database retrieval system