KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_890956Help
Entry
ARALYDRAFT_890956 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    ARALYDRAFT_890956
Enzymes [BR:aly01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     ARALYDRAFT_890956
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth
Motif
Other DBs
NCBI-GeneID: 9327118
NCBI-ProteinID: XP_002891056
UniProt: D7KJ97
Position
Unknown
AA seq 577 aa AA seqDB search
MEAATMGFVAKTLPHLGNGTRLPLKTKLSLFPMHLLHNHITLSRRSTKQNLCVKATSESS
GDVESSRPLPHVAPTLWGDHILSVPTENSEFDSLETEIESIIKPKVKNMLMSSHNTDKER
ILLIHLLMCLGTSHYFEKEIEEILDQAFEKLDSLIRDEDDLETIAIMFEVFRLYGHQISC
DVFDRFKGVDGKFKHLVSDVRGILQLYEGAHLTTPSEDVMDEALSFTRYHLESLAGQEAT
APHMAQHILNALYKPRFFKLQIEAAREYLSFYEKESHDETLLKFAKLNFNFCQLHYVREL
KTLTKWWKDIGLVYKLPFIRDRLLETFAGVIALFFEPHYSLGRIITTKASQVTIVMDDAC
DAYGTCSEVRSFIDSLQSFRIIIRSMMETMEDIEREMKPRGRSSSVQYLIEELKIYAESY
VELSKWSRSGHVPTFDKYIEVGIVSSGMRFLGMLSFITLEDCDENQTTEWFESKPNILQD
DMRRGEVANGVNCYMKQHGVTKEVAVRKIKKMIRDSYKIVMEEFLTTKGVPRPVLVRCLN
MIRLIKLFYYKEGDGYTNPQGELKDLITSLFFHPLPF
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagcaacaatgggttttgttgctaaaactctccctcaccttggcaatggcact
cgtcttcctcttaagaccaaactctcgctctttcctatgcatttgcttcacaaccacatt
actctttctcggagatcgacaaaacaaaacttatgtgttaaggcaactagtgagagtagt
ggtgatgttgagagtagccgtcctttgcctcatgttgctcccactctttggggagatcac
atcctctctgtccccaccgaaaactcggaatttgattcactagagacagagattgaatca
attataaagccgaaagtgaagaacatgctaatgtcctctcacaacactgataaagagaga
atattactcatccacttgcttatgtgtcttggtacttcccattactttgagaaggaaatc
gaagagattctagaccaggcttttgagaagttggactcgttaattagagacgaagatgat
ttggaaacaattgccatcatgtttgaggttttcagattatatggacatcagatttcttgt
gatgtgttcgatagattcaaaggtgttgatgggaagttcaaacacctagtcagtgatgtt
aggggaatactacagctgtatgaaggagcgcatctcacgacaccctccgaagatgtaatg
gacgaagccctgagttttacaaggtatcacttggaatctctggccggacaagaagcgacg
gctcctcatatggcacaacatatactaaacgcattgtataaacctcggtttttcaagtta
caaatagaagctgccagggaatatctttctttctatgaaaaagagagtcatgatgagacg
ttgctcaagtttgcgaagctcaacttcaacttttgccagctccattacgttagagagcta
aaaactctcactaaatggtggaaggacattggtcttgtatataagctacctttcattaga
gacaggcttttggagacctttgccggtgtcatagcgttgtttttcgagccacactattca
ttggggagaattataaccactaaagcttcccaagttacaatagttatggatgatgcatgt
gatgcatatggaacttgctctgaagttagaagtttcatcgattctttgcaaagtttcaga
atcatcatccgaagtatgatggaaactatggaagatattgaaagagaaatgaagccgcgc
ggaagatcctctagtgtgcaatacttgatagaagagcttaagatctatgcggaatcgtac
gtagagttatcaaaatggtcccgatcaggtcatgttccaacctttgataaatacattgag
gttgggattgtctcgtcagggatgagattcttgggaatgttaagctttataacgctggaa
gattgcgatgaaaaccaaacgactgagtggttcgaatccaaacctaatatcttacaagat
gatatgaggagaggagaggtggctaatggggtgaactgttacatgaagcaacatggtgtt
actaaagaagtggcggttagaaaaattaagaagatgattagagatagttataagatagtg
atggaggagttcttgacgacaaaaggtgtaccacgtccagttctggtacggtgcctcaac
atgataagattgatcaagctgttttattacaaggagggtgatggatacaccaatccccaa
ggagagctcaaagacctcatcacatctttgttcttccaccctcttccgttttga

DBGET integrated database retrieval system