KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_893425Help
Entry
ARALYDRAFT_893425 CDS       T01578                                 

Definition
(RefSeq) alpha 1,4-glycosyltransferase family protein
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00601  Glycosphingolipid biosynthesis - lacto and neolacto series
aly00603  Glycosphingolipid biosynthesis - globo and isoglobo series
aly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    ARALYDRAFT_893425
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    ARALYDRAFT_893425
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aly01003]
    ARALYDRAFT_893425
Enzymes [BR:aly01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     ARALYDRAFT_893425
Glycosyltransferases [BR:aly01003]
 Glycan extension
  P blood group
   ARALYDRAFT_893425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth TcdA_TcdB
Motif
Other DBs
NCBI-GeneID: 9322635
NCBI-ProteinID: XP_002888110
UniProt: D7KW57
Position
Unknown
AA seq 436 aa AA seqDB search
MEQSRRTEQVLLVQRLKRLIVSFVFCLPMSLLGLLLMLLLIYNSFSVFSLHLVPTSPIQS
TLSPTHLQILHHQTSTSSSQSDSSLLLVVKETSLGFIQKQNVSSTRTERKTRRFKRRTEL
TSEITQRLQVKSRQRFKTKFKSFLSKSSCESLFFMTWISSIESFGDRERFTIESLFKFHP
NSCLILVSNSFDCDRGTLILKPFTDKGLKVLPIKPDFAYIFKDTSAEKWFERLKKGTFSP
GVIPLEQNLSNLLRLVLLYKYGGIYLDTDVIILKSLSNLHNVIGAQTVDPVTRKWSRLNN
AVLIFDKNHPLLKRFIDEFSRTFNGNKWGHNGPYLVSRVIARINISSSSDLGFSVLPPSA
FYPVDWTRIKGFYRAPTSETEANWLRKRLTHLRKNTFAVHLWNRESKKLRIEEGSIIHQL
MSYSCIFCNSSSLHLS
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggaacagagcagaagaacagaacaagttctgttagtgcaaagattgaaaagattgata
gtctcttttgttttttgtcttcccatgtctcttcttggtctccttctcatgcttctctta
atctacaacagcttctctgtcttctctcttcatcttgttccaacctcacctattcaatct
accctttcaccaactcatcttcagattcttcatcatcagacatcaacatcatcatctcag
tcagattcttcattgttgcttgtggtgaaagaaacctctttagggttcatacagaagcag
aacgtttcgtctacgaggacagagagaaagacgaggagattcaagagaagaaccgagtta
acttctgagataacacagcggttacaagtcaaatcaagacagagatttaagacgaagttc
aagtctttcttgtccaaatcatcttgtgagtcactcttcttcatgacttggatctcctcc
atcgaatctttcggtgatcgagagcgatttaccatagagagtctcttcaaatttcaccca
aacagctgtttgatcttggtctcaaactcatttgactgtgacagaggaaccctaatcttg
aaaccctttacagataaagggcttaaagtgcttccaattaaacctgattttgcatacatc
ttcaaagatacatcagcagagaaatggtttgaaagattgaagaaaggaacgtttagtcca
ggagtgattccattagagcaaaacctctctaaccttctaagattagtcttgctctacaaa
tacggcggaatctacttagacacagacgtaataatcctcaaatctctcagcaatctccac
aacgtaatcggagcacaaacagttgacccggttacaagaaaatggagtaggctcaacaac
gcggtgctcatcttcgacaagaaccatcctttgcttaaaaggttcatcgacgaattctca
agaaccttcaacggtaacaaatggggccacaacggtccctacttagtgtcgagagtcatt
gcaagaatcaacatttcctcctcttcggatttgggattctcagttcttccaccatctgca
ttttatccggtggattggactagaatcaaaggattctacagagcgccgacgagtgagacc
gaggctaactggttgcggaagaggcttacgcatttacgcaaaaatacattcgctgttcat
ctttggaacagagagagtaagaaacttaggattgaagaaggaagcatcattcatcaactc
atgtcttattcttgcatcttttgtaactcttcttctttacatttaagttaa

DBGET integrated database retrieval system