KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_894670Help
Entry
ARALYDRAFT_894670 CDS       T01578                                 

Definition
(RefSeq) 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding protein
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / O-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00130  Ubiquinone and other terpenoid-quinone biosynthesis
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    ARALYDRAFT_894670
Enzymes [BR:aly01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     ARALYDRAFT_894670
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     ARALYDRAFT_894670
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     ARALYDRAFT_894670
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     ARALYDRAFT_894670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N MR_MLE_C TPP_enzyme_M_2 Abhydrolase_1 Abhydrolase_6 TPP_enzyme_C Ndr BAAT_C Hydrolase_4 Abhydrolase_2 Abhydrolase_3 DLH Thioesterase Esterase DUF2974 Lipase LIDHydrolase TPP_enzyme_M SIR2_2
Motif
Other DBs
NCBI-GeneID: 9324753
NCBI-ProteinID: XP_002887212
UniProt: D7KWW2
Position
Unknown
AA seq 1716 aa AA seqDB search
MRSSFLVSNPPFLPSLIPRHSSRNSFRRSRERFSFAESLRVSLHGIGRNIEVAHGVQFDG
PIMDRDALEVNLGDDLMVQVCVTRTLPPALTLELGLESLKEAVNELKTNPPQSSSGVLRF
QVAVPPSAKALFLFCSQPTSSDVFPVFFLSKETLEPSYKSLYVKEPHGVFGIGNALSFVH
PSSIDSKGHSMMKTFLSDESAMVTAYGFPDIEFNKYSTVNSKGGSSYFFVPQIELDEHEE
VSILAVTLAWNESLSYRFEQTISSYEKSIFQVSSHFCPNLEDHWFKHLKSSLAKFSVEEI
HPIEMEHMGFFTFSGRDQADVKELKSIQSSCQFHCKLSPDVVFSNNMLNRETEVSNFLKD
EANINAVWASAIIEECTRLGLTYFCVAPGSRSSHLAIAAANHPLTTCLACFDERSLAFHA
IGYAKGSLKPAVIITSSGTAVSNLLPAVVEASEDFLPLLLLTADRPPELQGVGANQSINQ
INHFGSFVRFFFNLPPPTDLIPVRMVLTTVDSALHWATGSACGPVHLNCPFRDPLDGSPT
NWSSNCLKGLDMWMSNAEPFTKYFQVQSHKSNGVTTGQITEVLQVIKEAKKGLLLIGAIH
TEDEIWASLLLAKDLMWPVVADVLSGVRLRKLFKPFLEKLTPVFVDHLDHALLSDSVRNL
IEFDVVIQVGSRITSKRVSQVLEKCFPFAYILVDKHPCRHDPSHLVTHRVQSNIVQFADC
VLNSQFPRRRSKLHGHLQALDGAIAREMSFQISAESSLTEPYIAHMLSKALTSESALFIG
NSMPIRDVDMYGCSSENSSHVVDMMLSAELPCQWIQVTGNRGASGIDGLLSSATGFAVGC
KKRVVCVVGDISFLHDTNGLAILKQRIARKPMTILVINNRGGGIFRLLPIAKRTEPSVLN
QYFYTSHDISIENLCLAHGVRYVHVGTKSELDDALFVPSVEEMDSIVEVESSINANAIVH
STLERFARQAAENSLGIISTSSLLHPMIGNVLLCQVSGIQYSKYRVKLCDRPTICSDEFS
QFHREGFILSLTLEDGSIGYGEVAPLDSNVENLMDVEGQLQLVLHLMNGAKFSYMLPLLN
GSISSWIWSELGITASSIFPSVRCGLEMALLNAMAVRHDSSLLGILHYQKDENGSAQPHS
AQICALLDSEGTALEVAYVARKLVEEGFSAIKLKVGRRVNSVQDALVMQEVRRAVGDQIE
LRADANCRWTFEEATEFGLLVKSCNLKYIEEPVQNKDDLIRFHEETGLPVALDETLDDFE
ECPLRMLTKYTHPGIVAVVIKPSVVGGFENAALIARWAQKHGKMAVISAAYESGLGLSAY
ILFASYLEMVNVKASTEQKQGTSPSVAHGLGTYRWLSEDVMMNTLGIFRSPYSGFVEGFV
ADASINLKDVKINNNVIVRTSKEIPVQRYELRVDVDGFSHFIRVHDVGQNAEGSVALFLH
GFLGTGEEWIPIMKGISGSARCISVDIPGHGRSRVQSHASETQTAPTFSMEMIAKALYKL
IEQITPGKVTIVGYSMGARIALYMALRFSNKIEGAVVVSGSPGLKDPVARKVRSATDDSK
ARMMVDNGLEIFLENWYNGGLWKSLRNHPHFSKIAASRLLHDDVPSVAKLLSDLSSGRQP
SLWEELEDCDTNISLVFGEKDVKFKQIATRMYREMSKSKKSVNNIIEMVEIPEAGHAVHL
ESPLRMILALRKFLTRVHKSSQRQLSQKLLLALKEM
NT seq 5151 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcttcgtttctagtttcgaatcctccgtttctaccttctctaatccctcgtcac
agttctagaaactccttcagacgtagcagagaacgcttctccttcgctgagtctcttcgt
gtttctcttcatggaatcggaagaaacattgaggtcgctcatggagttcaatttgatggt
ccgattatggatagagatgctttggaggtgaatttaggtgatgatttgatggttcaagtg
tgtgtgactcgtacattgcctccagctttgactcttgagcttggccttgagagcctcaag
gaagctgttaacgaattgaagactaatcctcctcagtcatctagtggcgtcttgcgattt
caagtggctgtgcctccaagtgcaaaagctttgtttttgttttgctctcagccgacatct
tctgatgtgtttcctgtgtttttcctctccaaggaaactttggagccttcttataaatca
ctctatgtaaaggaacctcatggggtttttggaattgggaatgcactctctttcgttcat
ccgtcttcaatcgactccaagggacatagcatgatgaaaacattcctctcagatgaatca
gctatggtgacggcctatggttttccagatattgaattcaacaaatactctactgtaaat
agcaagggtggctcttcttactttttcgttcctcagattgagttagatgagcacgaggag
gtctctattttagcagttacattggcatggaatgaatctctctcttacagatttgagcaa
acaattagttcatatgagaaatcaatttttcaggtttcttctcatttctgcccaaattta
gaggatcactggttcaaacatctaaaaagctctctagctaagtttagtgtagaagagata
catccaattgaaatggagcatatgggctttttcactttttctgggagagatcaggctgac
gtcaaggaactgaaaagtatacaatcatcatgtcagttccattgcaagctttcacctgac
gttgttttctcaaacaatatgctgaatcgagagactgaagtgagcaacttcttgaaagat
gaggctaacatcaatgctgtatgggcatcagctataattgaagaatgcactcgtcttggt
ttgacgtacttttgtgtagctcctggatcaaggtcttcccatcttgcaattgctgctgcc
aaccatccccttacaacgtgtcttgcatgctttgatgaacgatctcttgcgtttcacgct
attggttatgctaaaggatccctcaaaccagcagtcattataacatcatcaggaactgcc
gtttcaaatcttcttccagcggttgttgaagccagtgaggatttcttaccactgctacta
cttaccgcagatcgtcctcctgaacttcagggagttggcgcaaatcaatcaataaatcaa
ataaaccacttcggttcgtttgtcagattcttcttcaatcttcctcctccgactgatctt
attccagtccgaatggtccttaccactgtagactctgctctacattgggcaacaggttct
gcttgtggaccagtacatctcaattgtccttttagagacccacttgacggtagtccaaca
aattggtcatccaactgcttaaaaggattagacatgtggatgtcgaatgctgaaccattc
acaaaatattttcaagtacaaagccataaaagcaatggtgtaacaactggccaaattact
gaggtcttacaagtaatcaaagaggctaagaagggtcttcttcttattggtgcaatccat
acagaggatgaaatttgggcttcgcttctgttggcgaaagatctgatgtggcctgtagtt
gcagatgtcttgtcgggtgtaaggctgcgcaagctttttaaaccttttcttgagaagttg
acgcctgtttttgttgatcatcttgatcatgccttgctttcagactctgtcaggaatttg
atagagtttgatgttgttatccaggttggaagtcggataacaagtaaaagagtttctcag
gtgctagagaaatgctttccatttgcatacattttagttgataagcatccatgccgacat
gacccatcacacctggtcactcacagggtccaaagcaacattgttcagtttgctgattgt
gtgctgaactctcaatttccaaggaggagaagcaagttgcatggtcatctacaagcattg
gatggtgctattgcacgggaaatgtcatttcaaatatctgctgaaagctccctgaccgaa
ccttacattgcacacatgctttctaaagcactaacatctgaatctgctcttttcatcggg
aatagtatgccaataagggatgtggatatgtatggatgtagttcagaaaattcttctcat
gtggtagatatgatgttgagtgcagaactaccatgtcaatggatacaagtaactggaaat
agaggagctagtggcattgatgggttgctcagctcggccactggctttgctgtaggatgc
aagaagagagtggtctgtgtggtgggggacatctctttccttcatgatacaaatggattg
gcgattttgaagcagaggattgcaaggaaaccaatgacaattcttgtgataaacaaccgt
ggaggtggaatcttccgacttcttcctattgcaaagagaacagagcctagcgtgttaaat
caatatttctatacatcacatgacatttccattgaaaacttgtgtttggcacatggtgtg
aggtatgtacacgttgggacgaaaagtgaacttgatgatgctctatttgtacccagcgtg
gaagagatggattccattgtggaggttgaaagctctataaacgctaacgcaatcgttcat
agcactttggagaggtttgcacgccaagctgcagaaaattccctgggcattatctctacc
agttctcttcttcatccgatgatcggaaatgtacttctttgccaagtctctggaatacaa
tattcgaagtacagagtcaaactgtgtgacagacctaccatatgttctgatgaattctct
caattccatcgagaaggatttatactctccctcactttggaggatggaagcattggctat
ggagaggttgcacctctggacagtaatgtagagaacttaatggatgttgaggggcagctt
cagttagttcttcacctcatgaatggagctaaatttagttacatgcttcctttgttaaat
ggctctatttcttcctggatttggagtgaacttggaattactgcatcatcgattttccct
agtgtcagatgtggtctggaaatggctcttctaaatgctatggcagtaagacatgattct
agtttgttggggatacttcattatcagaaagacgaaaatggttctgctcagccacattct
gctcaaatatgtgcccttcttgattctgaaggtaccgcattggaggtcgcatacgttgct
agaaaacttgttgaagaagggttcagtgctattaaacttaaagttggtcgtcgagtgaac
tctgttcaagatgctttagttatgcaagaagtaaggagagccgttggcgatcaaattgaa
ctccgtgcagacgcaaattgtcgttggacttttgaagaggctacagagtttggtttgttg
gtgaaaagctgtaatttaaaatatattgaggaacctgtccagaataaagatgaccttata
aggtttcatgaagaaactggattaccagtggcacttgatgagactcttgatgattttgag
gaatgtcctctacgtatgcttaccaaatatacccatcctggaatagttgctgttgttatt
aaaccaagtgttgtgggagggtttgagaatgcagccctgattgctcggtgggcacagaag
catggaaaaatggctgttattagtgctgcatacgaaagtggcctaggtttatcagcatat
attttatttgcatcatatttggagatggtaaacgtcaaagcatccacagagcagaagcaa
ggaacatccccttctgtagcccatggtcttggaacttatcggtggcttagtgaagacgta
atgatgaatacattagggatatttcgtagcccttatagtggatttgttgaaggatttgtt
gctgatgctagtataaatctaaaggatgttaagataaacaacaatgttattgttagaacc
agtaaagaaattcctgtccagaggtatgaactgagggtggatgtagatgggttctctcat
ttcattagagtccacgacgttgggcagaatgcagaaggaagtgtagctttgtttcttcat
ggatttcttggaactggtgaagaatggatccccatcatgaagggtatctcgggatctgcg
agatgcatttcagtcgatattcctggtcacggaaggtcaagggtacaaagtcatgctagt
gagacccagacggccccaactttctcaatggagatgatagcgaaggcattgtataagttg
attgagcaaattactcctgggaaagtaactatagttggatattccatgggagcaagaata
gcactgtacatggctttgaggtttagcaacaagatcgaaggagctgtcgtggtatcaggg
agcccgggactcaaggatccagttgcaaggaaagttcgaagtgctacagatgattccaaa
gcacgaatgatggttgacaatggactagaaatctttctagagaactggtacaatggaggc
ttgtggaagagcttgagaaatcatccccattttagtaaaatagctgcaagccgcttgcta
catgacgatgttcctagtgttgcaaagctcctgtctgatctaagcagtgggagacaaccg
tcattgtgggaagagttggaggattgtgatacaaatatctcgctcgtattcggagagaaa
gatgtcaaattcaagcaaatcgctactagaatgtaccgcgagatgagtaaaagcaagaag
agcgtaaacaatatcatcgagatggttgaaatcccagaggctggtcacgctgtccatctc
gagagccctcttcgcatgattctcgcccttagaaaattcttaacaagagtgcacaaaagt
tcacagagacagctttctcagaagctcttgttagcactaaaagaaatgtaa

DBGET integrated database retrieval system