KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_895010Help
Entry
ARALYDRAFT_895010 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00564  Glycerophospholipid metabolism
aly01100  Metabolic pathways
Module
aly_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ARALYDRAFT_895010
Enzymes [BR:aly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     ARALYDRAFT_895010
    2.7.1.82  ethanolamine kinase
     ARALYDRAFT_895010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH Choline_kin_N Haspin_kinase EcKinase Pkinase
Motif
Other DBs
NCBI-GeneID: 9323447
NCBI-ProteinID: XP_002887383
UniProt: D7KYX2
Position
Unknown
AA seq 347 aa AA seqDB search
MAIKTKTSLIPSCSSPEDLKRVLQTLGSSWGDVVEDLERLEVVPLKGAMTNEVYQINWPT
LNGEDVHRKVLVRIYGDGVDLFFNRDDEIKTFECMSHHGYGPKLLGRFSDGRLEEFIHAR
TLSADDLRIVETSDFIAAKLREFHKLDMPGPKNVLLWERLRTWLKEAKNLASPIEMDEYR
LDVMEDEINLLEERLTRGDQEIGFCHNDLQYGNVMIDEETNAITIIDYEYSSFNPIAYDI
ANHFCEMAANYHSDSPHILDYTLYPGEEERRRFISTYLGSTGKATSEEEIERLLNDAESY
TLANHIFWGLWGIISGHVNKIEFDYMEYARQRFEQYWLRKPLLLDLP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcaagacaaagactagtctgattccaagttgttcatcaccggaggatctaaaa
cgcgttttgcaaacgctaggttcaagctggggagatgtagttgaagatctggaacgtctt
gaggttgttccgttaaaaggagctatgactaacgaggtttatcagattaattggcctact
ttaaacggcgaagatgttcaccggaaagttcttgttcggatctacggtgatggcgttgac
cttttctttaacagagatgatgaaatcaaaacctttgagtgtatgtctcatcatggttat
ggtcctaagcttcttggtcgcttctctgatggtcgtcttgaagaatttatccacgcaaga
actctttctgcagatgatcttcgtatcgtagaaacatctgatttcatcgctgcgaaacta
agagagtttcataagcttgatatgcctggtccaaagaacgttcttctctgggaaagactc
aggacttggcttaaggaggctaagaacttggcttcaccaatagagatggatgagtatcgg
ttggatgttatggaagatgaaatcaatttgttggaagagagacttactaggggtgatcaa
gagattggtttctgtcacaacgatctccagtacggaaatgtcatgattgatgaagaaacc
aatgccattacaatcatagactatgagtattcgagtttcaacccaattgcttatgacatt
gcaaaccacttctgtgaaatggctgctaattaccattcagactctcctcatattctggat
tacactctatatccaggagaagaagaaaggagaaggttcatcagcacatatcttggctct
acagggaaagcaacaagtgaggaagaaatagagaggttattgaatgatgcagagagctac
actttagcaaaccatatcttttggggcttatggggaatcatctcgggacatgtgaacaag
attgagttcgattacatggaatatgcaaggcagagatttgaacagtactggcttagaaag
cctttgctgctggatttaccttga

DBGET integrated database retrieval system