KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_895735Help
Entry
ARALYDRAFT_895735 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00906  Carotenoid biosynthesis
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
Module
aly_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    ARALYDRAFT_895735
Enzymes [BR:aly01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     ARALYDRAFT_895735
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 9323799
NCBI-ProteinID: XP_002889190
UniProt: D7KVA5
Position
Unknown
AA seq 121 aa AA seqDB search
MVNRNLLGKKTRFAYLALTEPWPKVSGFVKVDLSTGDIQKYIYGDGKYGGEPLFLPSGDG
EEDGGYIMVFVHDEEKVKSELQIINAVNMKLEATVTLPSRVPYGFHGTFISKEDLSKQAL
C
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaccggaatttattaggtaaaaaaacacggtttgcttatttggctttaaccgaa
ccgtggcctaaagtgtccggtttcgttaaagtggacttatcgaccggagatattcaaaag
tatatatatggagatgggaaatacggaggagagcctctgtttctgccttccggtgacggt
gaagaagacggtggttacattatggtgttcgttcacgacgaggagaaggtgaaatcggaa
ctccaaatcataaacgccgttaatatgaagcttgaagctaccgttacgcttccgtcgaga
gtgccttatggtttccacggaacgttcatcagtaaggaagatttatcgaagcaagctttg
tgttaa

DBGET integrated database retrieval system