KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_902192Help
Entry
ARALYDRAFT_902192 CDS       T01578                                 

Definition
(RefSeq) ATGPX2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00480  Glutathione metabolism
aly00590  Arachidonic acid metabolism
aly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    ARALYDRAFT_902192
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ARALYDRAFT_902192
Enzymes [BR:aly01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ARALYDRAFT_902192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 9315403
NCBI-ProteinID: XP_002881181
UniProt: D7LDM4
Position
Unknown
AA seq 169 aa AA seqDB search
MADESPKSIYDFTVKDIGGNDVSLNQYKGKTLLIVNVASKCGLTDANYKELNVLYEKYKE
QGLEILAFPCNQFLGQEPGNNEEIQQTVCTRFKAEFPIFDKVDVNGKNTAPLYKYLKAEK
GGLLIDAIKWNFTKFLVSPDGKVLQRYSPRTSPLQFEKDVQTLLGQASS
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgaatctccaaagtctatctacgacttcaccgtcaaggatatcggaggtaac
gatgtgagtttgaaccaatacaaaggcaaaactcttctgattgtcaatgttgcttccaaa
tgtggtctgactgatgccaactacaaggaactgaatgttctgtacgagaaatacaaggag
caagggttggagatattagcattcccttgtaaccagttcttaggacaagaaccaggtaac
aatgaagagattcaacaaactgtctgcaccaggttcaaagctgaattccccatctttgac
aaggtggatgtgaacgggaaaaacacggcgccattatacaaatacttgaaagcagagaaa
ggaggtttgctcattgatgccatcaaatggaatttcaccaaattcttggtttctcctgat
ggcaaagtcttacagagatattctcccagaacctctcctcttcaattcgagaaggacgtt
caaactctgttgggacaggcttcttcttga

DBGET integrated database retrieval system