KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_902730Help
Entry
ARALYDRAFT_902730 CDS       T01578                                 

Definition
(RefSeq) ATCWINV4
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00052  Galactose metabolism
aly00500  Starch and sucrose metabolism
aly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ARALYDRAFT_902730
   00500 Starch and sucrose metabolism
    ARALYDRAFT_902730
Enzymes [BR:aly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     ARALYDRAFT_902730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 9317495
NCBI-ProteinID: XP_002881429
UniProt: D7LIP4
Position
Unknown
AA seq 591 aa AA seqDB search
MGGVSNLISVLLFLVITNLSNQNIKGIVAFHQIYEELQSESVESVNHLHRPSFHFQPPKH
WINDPNGPVYYKGLYHLFYQYNTKGAVWGNIIWAHSVSKDLVNWEALEPAIHPSKWFDIG
GTWSGSITIVPGKGPIILYTGVNQNETQLQNYAIPEDPSDPYLRKWIKPDDNPIAMPDYT
MNGSAFRDPTTAWFSKDGHWRTVVGSKRKRRGIAYIYRSRDFKHWVKAKHPVHSKESTGM
WECPDFFPVSLTDFQNGLDLDYVGPNTKHVLKVSLDITRYEYYTLGKYDPKKDRYIPDGN
TPDGWEGLRFDYGNFYASKTFFDYKKNRRILWGWANESDTVEDDILKGWAGIQVIPRTVL
LDSSKKQLMFWPVEEIESLRGNYVRMNNHDIKMGQRIEVKGITPAQADVEVTFYVGSLEK
AETFDPSFKFKPLDLCKIKGSNVRGGVGPFGLITLATPDLEEYTPVFFRVFKDTKTHKPK
VLMCSDARPSSLKQDKGPLAKDRMYKPSFAGFVDVDMADGRISLRSLIDHSVVESFGALG
KTVITSRVYPVKAVKENAHLYVFNNGTQTVTIESLNAWNMERPLQMNDGAL
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgggtggtgtttcaaatcttatttctgtcttattatttctcgtaataaccaatttaagc
aatcaaaatatcaaaggaattgttgcatttcatcagatttacgaagaattgcaatctgaa
tcagtcgagtcagtgaatcatcttcacagacctagtttccactttcaacctccaaagcat
tggattaacgatccaaatggtccagtatactacaaaggtctctaccatctcttctaccaa
tataataccaagggtgcggtttggggtaatattatatgggcccattcggtttctaaagac
ttggttaactgggaggctcttgaaccggccatccatccttcaaaatggttcgatatcgga
ggtacatggtcaggttcaataacaatcgtaccgggaaaaggaccgattatcctctatacc
ggtgttaatcagaatgaaactcagttgcaaaactatgcaatcccggaggacccatcagac
ccttacctaaggaaatggattaaaccggacgataacccgattgcaatgccagactatacc
atgaacggttcagcatttcgtgacccgaccacggcttggttctccaaagacgggcattgg
agaaccgttgtgggatcaaaaagaaagcgtagaggaatagcttacatctacagaagccga
gatttcaagcattgggtcaaagctaagcacccggttcactctaaagagtcaaccggtatg
tgggaatgtcctgatttctttccggtttccttaaccgatttccaaaacggtttggacttg
gattacgtcggtccaaacaccaagcatgtgttgaaggttagcttggacataactcggtat
gagtattacacgcttggtaaatacgatcctaagaaggaccggtacataccggacggtaat
actcccgatggttgggagggtttaaggttcgattacggtaatttctacgcttccaagaca
ttctttgactacaaaaagaacagaagaatcttatggggttgggccaatgaatctgacacc
gttgaagatgatattttgaagggttgggctggtattcaggtaattccaagaacggtactt
cttgattcaagcaagaagcaactaatgttttggcctgtcgaagagatagagtcattaaga
ggtaactatgtccgaatgaacaaccatgacatcaagatgggtcaacgcatagaagtcaaa
ggaatcactccagctcaagccgatgtggaagtaacgttctatgttggaagtctagagaaa
gctgagacatttgacccgagtttcaagttcaaaccattggatttgtgtaagattaaaggc
tcgaatgtgagaggcggtgtaggaccttttggtttgatcacattagcgactcctgatttg
gaagagtacactcctgtcttctttagagtcttcaaagacactaaaactcataagcctaaa
gttctcatgtgttccgatgctagaccgtcgtcgttaaagcaagacaagggtccactcgca
aaagataggatgtataaaccatcgtttgctggttttgtggatgttgatatggctgatgga
aggatctctctaaggagtttgattgatcattcggtcgtagagagctttggagcattaggg
aaaacggtgataacatcaagagtgtatccagtgaaggcagtaaaagagaatgcacatttg
tatgtgtttaacaatggaacacagactgtgaccatagagagtctcaatgcttggaacatg
gaacgtcctttacaaatgaatgatggagctctttaa

DBGET integrated database retrieval system