KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_906076Help
Entry
ARALYDRAFT_906076 CDS       T01578                                 

Definition
(RefSeq) protein-l-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Enzymes [BR:aly01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     ARALYDRAFT_906076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCMT Methyltransf_31 PrmA Methyltransf_25 Methyltransf_32 Methyltransf_23 MTS CMAS Methyltransf_11 MetW Fibrillarin ACP_syn_III_C FtsJ Methyltransf_16 Ubie_methyltran EF-hand_5 RrnaAD
Motif
Other DBs
NCBI-GeneID: 9311964
NCBI-ProteinID: XP_002877607
UniProt: D7LRL7
Position
Unknown
AA seq 230 aa AA seqDB search
MKQFWSPRSINKNKAMVEKLQNHGIVTSDEVAKAMEAVDRGVFVPDRSSAYVDCPMSIGY
NVTISAPHMHAMCLQLLEKHLKPGMRVLDVGSGTGYLTACFAVMVGSQGRAIGVEHIPEL
VASSVKNIEASAASPLLKEGSLAVHVGDGRQGWAEFAPYDAIHVGAAAPEIPEALIDQLK
PGGRLVIPVGNIFQDLQVVDKNSDGSVSIKNETSVRYVPLTSREAQLRGD
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaattctggagtccaagaagtatcaacaagaacaaagctatggtggagaagctg
caaaatcatggtatagttacgtcagatgaagttgctaaagctatggaggcagtggataga
ggcgtatttgtaccagatcgttcctctgcttatgtagattgtcccatgtctattgggtat
aatgtgactatatcagcacctcatatgcacgcaatgtgtcttcaacttcttgaaaaacat
ttgaaaccgggaatgcgtgttcttgatgtcggctcggggactgggtacttaacggcttgc
tttgcggttatggttggatcccaagggcgtgctattggtgtggaacatattcctgagctg
gtggcttcttctgttaagaatattgaagcgagtgctgcttcgccattgttgaaagaaggg
tctcttgctgttcatgttggcgatgggaggcaaggatgggctgagtttgctccttatgat
gctattcatgtcggagcagcagcaccggagatcccagaggcgttgattgatcagttgaag
cccggtgggagactggtgatcccggttgggaacatattccaagatctgcaagtggtggac
aagaactcagatggttcggttagcatcaagaatgaaacctcagttcgttatgttcctttg
actagccgtgaagcccagctgagaggggactga

DBGET integrated database retrieval system