KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_906963Help
Entry
ARALYDRAFT_906963 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00010  Glycolysis / Gluconeogenesis
aly00051  Fructose and mannose metabolism
aly00562  Inositol phosphate metabolism
aly00710  Carbon fixation in photosynthetic organisms
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
aly01200  Carbon metabolism
aly01230  Biosynthesis of amino acids
Module
aly_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aly_M00002  Glycolysis, core module involving three-carbon compounds
aly_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARALYDRAFT_906963
   00051 Fructose and mannose metabolism
    ARALYDRAFT_906963
   00562 Inositol phosphate metabolism
    ARALYDRAFT_906963
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    ARALYDRAFT_906963
Enzymes [BR:aly01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ARALYDRAFT_906963
Exosome [BR:aly04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ARALYDRAFT_906963
  Exosomal proteins of bladder cancer cells
   ARALYDRAFT_906963
  Exosomal proteins of melanoma cells
   ARALYDRAFT_906963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM RNA_pol_Rpa2_4
Motif
Other DBs
NCBI-GeneID: 9314102
NCBI-ProteinID: XP_002876302
UniProt: D7LV43
Position
Unknown
AA seq 254 aa AA seqDB search
MARKFFVGGNWKCNGTAEEVKKIVNTLNEAQVPSQDVVEVVVSPPYVFLPLVKSTLRSDF
YVAAQNCWVKKGGAYTGEVSAEMLVNLDIPWVILGHSERRAILNESNEFVGDKVAYALAQ
GLKVIACVGETLEEREAGSTMDVVAAQTKAIADRVSNWSNVVIAYEPVWAIGTGKVASPA
QAQEVHDELRKWLAKNVSADVAATTRIIYGGSVNGGNCKELGGQADVDGFLVGGASLKPE
FIDIIKAAEVKKSA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccagaaagttcttcgtcggaggcaactggaaatgcaacggaactgctgaggaggtg
aagaagattgtgaacactcttaatgaagctcaagtaccttcacaggatgttgtagaggtt
gtggttagccctccatatgttttccttcccctggttaagagtacattgaggtctgacttt
tatgttgcggcacaaaactgttgggttaagaaaggtggtgcttacactggtgaagtgagc
gctgagatgcttgtgaacttggacatcccatgggttatccttggtcactctgaaaggagg
gcaatccttaatgaatcaaacgagtttgtcggagacaaggttgcctatgcacttgctcaa
ggtttgaaagtgattgcttgtgttggtgagactcttgaggagcgggaagctgggtcgacc
atggatgttgtggctgcccagaccaaagctatcgctgatcgggtgtcaaactggtcaaat
gttgtcatagcctatgagccagtgtgggccattggaaccggaaaggtcgctagcccagct
caagctcaagaagtacatgatgagcttaggaaatggctggccaagaacgtgagtgctgat
gttgctgctacaacccgcatcatttatggaggatccgtcaatggtggtaactgcaaggag
ctaggtggtcaggccgatgttgatggtttcttggtcggtggtgcttctctaaagcctgag
tttatcgacatcattaaggctgcagaggtgaaaaaaagcgcttaa

DBGET integrated database retrieval system