KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_911770Help
Entry
ARALYDRAFT_911770 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
KEGG Orthology (KO) [BR:aly00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ARALYDRAFT_911770
Enzymes [BR:aly01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     ARALYDRAFT_911770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 EF-hand_6 DAO EF-hand_7 Pyr_redox_3 EF-hand_5 NAD_binding_8 EF-hand_8 p25-alpha
Motif
Other DBs
NCBI-GeneID: 9308799
NCBI-ProteinID: XP_002872730
UniProt: D7M1X3
Position
Unknown
AA seq 583 aa AA seqDB search
MRNFSIFERFSKAFQDHPSLTRILVVSTISGGGLIAYSEANASYGANGAGIVETGTKKKK
VVLLGTGWAGTSFLKNLNNSQYEVQIISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIG
RKKNVDTSYLEAECFKIDPASKKVYCRSKQGLSSNGKKEFSVDYDYLVIATGAQSNTFNI
PGVEENCHFLKEVEDAQRIRKTVIDSFEKASLPELSDEERKRILHFVVVGGGPTGVEFAA
ELHDFVTEDLVSLYPRAKGSVRITLLEAADHILTMFDKRITEFAEEKFSRDGIDVKLGSM
VTKVNEKDISAKTKGGEVSSIPYGMIVWSTGIGTRPVIKDFMKQIGQGNRRALATDEWLR
VEGTDNIYALGDCATINQRKVMEDVSAIFSKADKDKSGTLTLKEFQEAMDDICVRYPQVE
LYLKSKRMRGIADLLKEAETDDVSKKNIELKIEEFKSALSQVDSQVKFLPATAQVAAQQG
AYLAKCFDRMEDCEKNPEGPIRMRGEGRHRFRPFRYRHLGQFAPLGGEQTAAQLPGDWVS
IGHSSQWLWYSVYASKQVSWRTRVLVVSDWMRRFIFGRDSSSI
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatttcagtatcttcgagagattctctaaagcttttcaagatcatccttctctc
accaggattctcgtcgtctccacgatcagtggtggtggacttatagcgtattctgaggca
aacgcatcctatggagcgaatggtgctggtattgttgaaactggaaccaagaagaagaag
gtggtattgctgggaactggatgggctggaactagtttcttgaagaatttgaataactct
cagtatgaggttcagattatatcacctcgaaactactttgctttcactcccttgttacct
agtgttacttgtggaactgttgaagctcgcagcgttgttgagcctattcgaaacattgga
agaaagaaaaatgttgatacttcttacctggaggcagaatgtttcaaaattgatccagca
agcaagaaagtttactgccgatccaaacaaggccttagttcaaatggaaaaaaggaattt
tctgttgactatgactatcttgtaattgcaactggagctcagtctaacacctttaacata
cccggagtggaggaaaactgtcattttctgaaagaggttgaagatgctcagagaatccgt
aaaactgtgattgattcctttgagaaggcaagtctaccagaactaagcgatgaagagcga
aagagaatcctgcattttgtggttgttggtggtgggccaacaggtgttgagtttgccgct
gagctgcatgattttgttactgaggatctagtcagtctctatcctagagccaagggttca
gtacgaatcacacttctcgaggccgcagaccacatcctgaccatgtttgataagagaatc
actgagtttgccgaagaaaagtttagcagagatggaattgatgtgaaacttggctctatg
gtaactaaagtgaatgagaaagatatatctgctaaaaccaaaggaggagaggtttcctct
attccttatggaatgattgtctggtcaactggtattggaactcgtcctgtgataaaagat
tttatgaaacaaattggtcagggtaatagacgtgctctggcaactgatgaatggcttcgc
gtagaaggaactgataatatatatgcccttggtgattgtgcaaccattaaccagcgcaaa
gtcatggaagatgtttctgctatttttagcaaagcagacaaagacaagtctgggacactg
actctcaaagagttccaagaagcaatggatgacatttgtgttagataccctcaagtggag
ctctacttgaagagtaaacgtatgcgtggcattgcagatcttcttaaagaagccgaaact
gatgatgtatccaagaagaacatcgaactgaagatcgaagaattcaaatcagctctttct
caggttgactcacaagtgaagtttcttccagctacagcacaggtcgctgcgcagcaaggt
gcttacctagctaaatgctttgatcgcatggaagattgtgagaagaatccagaaggtccc
attaggatgagaggagaaggtcgtcatcgtttccgccccttcaggtacaggcatttggga
caatttgcaccactgggaggggagcaaacggcagcacaacttccaggagattgggtttct
attggacatagcagccagtggctctggtattccgtctacgccagtaagcaagtgagctgg
cgtacgagagtgcttgtggtttcagattggatgaggcgtttcatctttggtagggattcc
agtagcatctga

DBGET integrated database retrieval system