KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_914833Help
Entry
ARALYDRAFT_914833 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00860  Porphyrin and chlorophyll metabolism
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ARALYDRAFT_914833
Enzymes [BR:aly01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     ARALYDRAFT_914833
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mg_chelatase MCM AAA_5 AAA_22 Sigma54_activat AAA_16 AAA AAA_29 DUF815 ABC_tran AAA_18 AAA_30
Motif
Other DBs
NCBI-GeneID: 9306114
NCBI-ProteinID: XP_002867988
UniProt: D7MCR6
Position
Unknown
AA seq 423 aa AA seqDB search
MASLLGTSSSAIWASPSLSSSSSTPSTSPICFRPGKLFGSKLNAGIQIRPKKNRSPYHVS
VVNVATEINSTEQVGKFDSKKSARPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMIMGDR
GTGKSTTVRSLVDLLPEINVVAGDPYNSDPIDPEFMGVEVRERVEKGEKVPVIATKINMV
DLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDS
AASGWNTVEREGISISHPARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDADLRVKI
VEERARFDSDPKDFRETYKTEQDKLQDQISTARANLSSVQIDRELKVKISRVCSELNVDG
LRGDIVTNRAAKALAALKGKDRVTPDDVATVIPNCLRHRLRKDPLESIDSGVLVSEKFAE
IFS
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctcttcttggaacatcttcttctgcaatctgggcttctccttctctctcttct
tcttcctctacaccttcgacttctcccatttgcttcaggccagggaaattgtttggaagc
aagttaaatgcaggaatccagataaggccaaagaagaacaggtctccttaccatgtttcg
gttgtgaatgtagccacagaaatcaactctactgaacaagtagggaagtttgattcaaag
aagagtgcgaggccggtttatccatttgcagctatagttgggcaagatgagatgaagtta
tgtcttctgttgaatgtgattgatccaaagattggtggtgtgatgattatgggagataga
ggaactggaaaatctacaactgttagatcattagttgatctgttacccgagattaatgta
gttgcaggtgacccgtataactcggatccgatagatcctgagtttatgggtgttgaagta
agagagagagttgagaaaggagagaaagttccagttattgcgactaagattaatatggtt
gatcttccgttgggtgcaacagaagatagagtttgtggaacaatcgatatcgaaaaggct
ttgacagaaggtgtaaaagcctttgagcctggtttgttggctaaagctaatagagggatt
ctctatgttgatgaagttaatcttttggatgatcatttggttgatgttcttttggattca
gctgcttctggatggaatacggttgagagagaaggaatttcgatttctcaccctgcgagg
tttatcttaattggttcaggaaatccggaagaaggagagcttaggccacagcttcttgat
cgttttggaatgcacgctcaagtagggacggttagagatgctgatttacgagtcaagatt
gtggaagagagagctcgttttgatagtgacccaaaggatttccgtgaaacttacaaaacc
gagcaggacaagcttcaagaccagatttcaactgctagggcaaatctttcctcagttcag
attgatcgggaattgaaggtgaagatctctagggtatgttcagagctcaatgtcgatggg
ttgagaggagacatagtgactaacagagcagcaaaagcacttgcagctctcaaagggaaa
gatcgagtaactccagatgatgttgcaactgttatccctaactgcttaaggcaccgtctg
aggaaagatccactggaatctatcgattcgggagtcctagtttccgagaagttcgctgag
attttcagctga

DBGET integrated database retrieval system