KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_918741Help
Entry
ARALYDRAFT_918741 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Protein phosphatases and associated proteins [BR:aly01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     ARALYDRAFT_918741
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_7 EF-hand_8 SPARC_Ca_bdg EF-hand_4 DUF2247
Motif
Other DBs
NCBI-GeneID: 9300498
NCBI-ProteinID: XP_002864422
UniProt: D7ML62
Position
Unknown
AA seq 226 aa AA seqDB search
MSQCVDGFKHLCTSVLGCFDLDLYKQSGGLGDPELLARDTVFSVSEIEALYELFKKISSA
VIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILGFEEFARALSVFHPNAPI
DDKIHFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLKDTVIENIIDKTFEEADTKHD
GKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVEDT
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagtgcgttgacggtttcaagcatttatgcacctcggttttagggtgttttgat
cttgatttgtataaacaatccggtggtcttggagatcctgaattgcttgcaagagacact
gtttttagtgtgagtgaaatagaagctctttatgagctgtttaagaaaatcagcagtgcc
gtgattgatgatgggcttataaacaaggaagagtttcagttggctttgtttaagacgaat
aaaaaagagagcttgtttgcagatcgggttttcgatttgtttgatacaaaacacaatgga
atactcgggtttgaggagtttgcccgtgctctctccgtatttcacccaaatgcgcctata
gatgacaaaatccacttttcatttcagctatatgatcttaaacagcaagggttcatcgaa
cggcaagaggtgaaacaaatggttgtcgctacgcttgctgaatctggaatgaatttgaag
gatactgtcatagagaacataatcgataagacgtttgaggaagcagacacaaaacacgat
ggaaagatcgataaggaagagtggagaagccttgttcttagacatcccagccttctgaag
aacatgactcttcagtatctcaaggatatcacgactacgtttccaagctttgtgttccat
tctcaggttgaagatacctga

DBGET integrated database retrieval system