KEGG   Alteromonas sp. Mac2: AV940_00580Help
Entry
AV940_00580       CDS       T05899                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
alz  Alteromonas sp. Mac2
Pathway
alz00620  Pyruvate metabolism
alz00630  Glyoxylate and dicarboxylate metabolism
alz01100  Metabolic pathways
alz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:alz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AV940_00580
   00630 Glyoxylate and dicarboxylate metabolism
    AV940_00580
Enzymes [BR:alz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     AV940_00580
    1.2.1.22  lactaldehyde dehydrogenase
     AV940_00580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AMJ89091
Position
136913..138337
Genome map
AA seq 474 aa AA seqDB search
MRIEKNFINNEFVSSTQNSLIDVYDPATEVLIAQVPAASPEEAASAIESATEAQRAWRKL
TSIERGGYLQKLADTLVLRKDDIGAALAEESGKSLEDATNEAVYAADITRYHAEWARRIE
GEIIPSDTPDENLLLQREAIGVVVALIPFNYPVYTFLRKIAPALITGNTVVVRPSNNTPC
SAFAIAKVIQEAGIPKGVVNVLTMTHATAELVCTHPKVGMITLTGSVGAGRKVLEYSQVN
IAKSSLELGGKTPAIVEPDADLEKAAREIVGSKNTNCGQLCTAVERAYVHEDIYDEFVAL
LHKNMKSQQFGSRVDNPGFMGPLVNGNARLNIHQMVERAIDDGANLELGGFIPEGKGYFY
PPTLLTNCRQDMEIVQEEIFGPVLPVLKYSNVDEALALANDHQFGLASVIYTENYRTAMK
VANEMEAGEVYINRTPSDPYQGFHAGWKRSGLGGDDGKHGMLEYTQTRLVVLKY
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcgaaaagaactttattaacaatgaatttgttagctctactcaaaattcatta
atagacgtttatgatcctgcaactgaagtgcttattgctcaggttccagcggcaagccca
gaagaagctgcatcggcaattgaaagtgctacagaagcacagcgcgcatggcgaaagctt
accagcatagaacgtggtggttacttacagaagttggctgacaccctggtattacgcaaa
gatgatattggtgctgcgctggctgaagagtcaggaaagagcctagaagacgcgaccaac
gaagctgtgtatgccgctgatataactcgttatcatgctgaatgggcgcgccgtatcgag
ggtgaaattattcccagcgatactccagatgaaaacctgttattgcaacgagaagctatt
ggcgttgtggtggcattaatcccgtttaactaccctgtttacacatttcttcgcaaaatt
gcaccggctcttattaccggaaatacggtggtagttaggcccagtaacaacacgccttgt
tcagcatttgccattgccaaagttattcaagaagcgggcattcctaagggtgtagtgaac
gtacttaccatgacccacgctacggcggaattggtgtgtacacaccctaaagtaggcatg
attacccttacgggaagcgttggcgctgggcgcaaggttctagagtactcgcaagttaat
attgctaaatcgtcgttggaactaggcggaaaaacccccgcgattgttgagccagatgcc
gacttagaaaaagcggcaagagaaatcgttggttctaaaaataccaactgcggccagctt
tgtactgcggtagagcgggcttacgtacacgaagatatctacgatgaatttgtagccttg
ctgcataagaacatgaaaagccaacagtttggtagccgtgtagacaaccctggtttcatg
gggccattagttaacggcaatgcgcgattgaacattcatcaaatggtggaaagagcgatt
gatgatggggctaacctagagcttggtggtttcattcctgaaggcaaaggctatttctat
ccgccgaccttactgactaattgccgccaagatatggaaatcgttcaagaagagatattt
ggacctgtattacctgttttgaaatattcaaatgtagatgaagcactggcgttagctaac
gatcaccagttcggtttggcgtcagtgatttacaccgaaaactatcgtaccgcaatgaaa
gtggcgaacgaaatggaagccggtgaagtgtacatcaaccgtactccttccgacccttat
caaggctttcacgccgggtggaaacgctcaggtttaggcggcgatgatggtaagcatggc
atgctggaatacacgcaaactcgcttagttgttcttaaatactag

DBGET integrated database retrieval system