KEGG   Alteromonas sp. Mac2: AV940_02300Help
Entry
AV940_02300       CDS       T05899                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
alz  Alteromonas sp. Mac2
Pathway
alz00564  Glycerophospholipid metabolism
alz01100  Metabolic pathways
alz01110  Biosynthesis of secondary metabolites
Module
alz_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:alz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AV940_02300
Enzymes [BR:alz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     AV940_02300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AMJ89402
Position
complement(566498..567436)
Genome map
AA seq 312 aa AA seqDB search
MLDWLKINLQYITPKHLLSRLVGKLAAAELGGFTTFLIKLFIKQYNVDMSEALHSDPAHY
RSFNAFFTRPLKPEVRTIDPREDVLIQAVDGTVSQFGDIEADSIFQAKGHDFSLTSLLGG
KPDLAAPFKDGKFATIYLAPRDYHRIHMPVEGTLTDMVYVPGELFSVNPLTAQNIPSLFA
RNERVVALFDTPVGKMAMVLVGATIVASIETVWAGTVSPPTGKNVQHWTYEKDTEASVHL
AKGDELGRFKLGSTIVVCFEKDMIDFDALAPGQVTRLGEPMAFAANAPVNTDAGVDLGDN
SGADLGTQATTS
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgctggactggcttaaaataaacttacaatacattacccctaaacatttgttgtcacgc
ctagtaggcaaattagcggcagcagagcttggtggtttcactacgtttcttatcaagctt
ttcatcaagcaatataatgttgatatgagcgaggctttgcattcagatcctgcccattac
cgcagtttcaacgccttcttcactcgcccattaaagcctgaagttcgcaccattgaccca
cgagaagatgtgttaattcaagcggtagatggcacggtaagtcaatttggcgacattgaa
gctgacagtatatttcaagctaaggggcacgattttagccttaccagcctattaggcgga
aagccagatttagcggctccatttaaagacggaaaatttgctaccatttatttagcccct
cgagactaccaccgcattcatatgccggtagagggtacgcttaccgacatggtgtatgtg
cctggcgagttattctcagtaaacccacttaccgctcaaaatattccaagcttgtttgcc
cgtaatgagcgtgttgtggcgctattcgatacacccgtaggcaaaatggctatggtactg
gttggcgctacgattgttgccagtatagaaaccgtttgggctggtactgtgtcgccacct
acaggtaaaaatgtacaacactggacttacgagaaagataccgaagcaagcgtacacctt
gcgaagggcgacgagctaggtcgctttaagttgggctctaccattgtggtatgtttcgaa
aaagacatgattgattttgatgcattagcacctgggcaagtaacccgtttaggtgaacca
atggcttttgctgcgaacgcgccagtaaatactgatgcgggcgttgatttaggcgataac
tcaggcgctgatttaggcacgcaagcgacaacaagctag

DBGET integrated database retrieval system