KEGG   Alteromonas sp. Mac2: AV940_03755Help
Entry
AV940_03755       CDS       T05899                                 

Definition
(GenBank) long-chain fatty acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
alz  Alteromonas sp. Mac2
Pathway
alz00061  Fatty acid biosynthesis
alz00071  Fatty acid degradation
alz01100  Metabolic pathways
alz01212  Fatty acid metabolism
alz02024  Quorum sensing
Module
alz_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:alz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AV940_03755
   00071 Fatty acid degradation
    AV940_03755
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AV940_03755
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:alz01004]
    AV940_03755
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:alz04147]
    AV940_03755
Enzymes [BR:alz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     AV940_03755
Lipid biosynthesis proteins [BR:alz01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   AV940_03755
Exosome [BR:alz04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   AV940_03755
  Exosomal proteins of breast cancer cells
   AV940_03755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C DUF4794
Motif
Other DBs
NCBI-ProteinID: AMJ89663
Position
complement(922022..923590)
Genome map
AA seq 522 aa AA seqDB search
MLTYPENVTCLADNIEAVLTKHADKPAYTALGQTLTFKEIDEKSAALARYFTHEAKLEAG
DRIAIQLPNLIQNPIAVYAALRAGLVVVNTNPLYTEREMKHQFTDSGATALVILSDLLPK
FDAIKSDTQIKTVVATSATELLDAATAPTLTGTVSLTDAINAGADLPAVVRPKTEFEALA
MLQYTGGTTGVSKGASLSHKNVMSNSVQMLDHLGGFFKEGEEVVVCPLPLYHIYAFTVCM
MALFAKGSHIVLIPNPRDIDGFIQTLKPHKITAFAGINTLFVGLGRHPEFAKLDFSKLHL
TMSGGTALTQGAVSIWKQVTGNTITEGYGLSETAPVVSFNLPGEEEIGTVGKPLQDTEVA
LLDSSDNPVGEGESGQIAVRGPQVMLGYWNRDDETGKVMTKDGYFKTGDIGVWVASGALK
IVDRLKDMIIVSGFNVYPNEVEDVLTAHPDIMEAAVVGKLDEKSGERVCAFITVSKPVTN
DDIIAFCKESLTNYKVPKELTVLEELPKSTVGKILRRELRSA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgttaacgtacccagaaaacgttacttgcctggccgacaatattgaagccgttcttact
aagcatgctgataagcctgcgtataccgcattgggtcaaacccttaccttcaaagaaata
gacgaaaaatctgctgccttagcgcgctacttcactcatgaagccaagctagaagccggc
gacagaattgctatccagctgcctaaccttattcaaaaccctattgccgtttatgctgct
ttgcgcgcaggcttggtagtggttaacactaacccgctttataccgagcgggaaatgaag
caccaatttactgatagcggcgcaacagcgttagttatcttaagtgatttactgccaaaa
tttgatgccattaaaagcgacactcaaattaaaaccgttgttgctacatcggcgactgaa
ttattagatgctgctacggcgcctactttaacaggtactgtatcgttaactgatgcgatt
aacgccggtgcagatttgcccgccgtggtaagacctaaaacagagtttgaagcccttgcc
atgttgcaatacacgggaggaactacaggggtatctaaaggcgcatcccttagccataaa
aacgttatgagcaacagcgttcaaatgcttgaccacctaggcgggttcttcaaggaaggt
gaagaagtggtagtttgtccacttcctttgtatcacatttatgcctttactgtttgtatg
atggcactattcgcgaagggcagccatatcgtgcttattccgaatcctcgtgatatcgac
ggtttcattcaaacattaaagccgcataaaattaccgcgtttgcgggcatcaatactttg
ttcgttggtttgggtcgtcacccagaatttgccaagctcgacttttcaaaactgcattta
accatgtctggtggtacagccctcactcaaggcgcagtatctatatggaaacaagtaaca
ggcaatactattactgaaggttacgggttgtcagaaaccgcgccagtggtttcttttaac
ttacctggcgaagaagaaattggtaccgttggtaaaccactgcaagatactgaagttgcg
ttgctagacagctccgataacccggtaggcgaaggagagtcaggacaaattgcggttcgc
ggaccgcaggttatgctgggctattggaacagagacgacgaaaccggaaaagtcatgaca
aaagatggctactttaaaaccggtgatatcggcgtttgggtagcatctggcgcacttaaa
attgtcgatcgcttgaaagacatgattattgtttctggtttcaatgtgtaccctaatgaa
gtagaagatgtactcactgcccatccagatattatggaagccgctgtagtcggtaaacta
gatgaaaaatctggtgagcgagtatgcgcgttcattaccgtcagcaagccagttactaac
gatgacatcattgcgttttgcaaagaaagcttaaccaattacaaagtacctaaggaactt
accgttttagaagagctgcctaaatctaccgtagggaaaatactccgtagagagctgcgt
tcagcctaa

DBGET integrated database retrieval system