KEGG   Alteromonas sp. Mac2: AV940_03805Help
Entry
AV940_03805       CDS       T05899                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
alz  Alteromonas sp. Mac2
Brite
KEGG Orthology (KO) [BR:alz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AV940_03805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AMJ89673
Position
complement(938197..938571)
Genome map
AA seq 124 aa AA seqDB search
MNESEIKVRVKTRHLPEHLPSDSPQFAFAYHVTIVNDSQETVQLINRYWQITDANGKTSE
VSGSGVVGKQPILKPGEDFDYTSGAVLDTPVGNMQGYYEMERENGERFRVPIEVFRLAVP
NILH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagtctgaaattaaggtgcgggtgaaaacccgtcacctgcccgaacatctacct
tctgattcgccacaattcgcgttcgcttatcacgtgaccattgtgaatgacagccaggaa
acggtacaactgattaatcgttactggcaaattaccgatgctaacggtaaaacctcagag
gtgagtggctcaggagttgtcggtaaacagcccatattaaaaccgggcgaagattttgac
tataccagtggtgcagtacttgataccccggtaggaaatatgcaaggctattacgaaatg
gagcgtgaaaacggtgaacgttttcgtgttcccattgaagtattccgtttagcggttccc
aacattcttcactaa

DBGET integrated database retrieval system