KEGG   Alteromonas sp. Mac2: AV940_09485Help
Entry
AV940_09485       CDS       T05899                                 

Gene name
phhA
Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
alz  Alteromonas sp. Mac2
Pathway
alz00360  Phenylalanine metabolism
alz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
alz00790  Folate biosynthesis
alz01100  Metabolic pathways
alz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:alz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    AV940_09485 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AV940_09485 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AV940_09485 (phhA)
Enzymes [BR:alz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     AV940_09485 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AMJ92676
Position
complement(2260400..2261203)
Genome map
AA seq 267 aa AA seqDB search
MAKSSVYQSKASDSKGVINWSEEENQIWAALYARQLPLLKTRACAQYMDGLSLLALPDDR
IPQLPDIDKVLLAQTGWKTAEVPALINFGEFFRLLANKQFPVATFIRSKDEFDYLQEPDI
FHEVFGHCPLLTNPAFAHFTHTYGKLGLAASKEDRIYLARLYWFTVEFGLVRSQANPEKL
EIYGGGILSSPGETLYALDSHEAIRKPLTATDALRTPYRIDIMQPLYYVLPDFDYLFELA
DMDIMSLVNKAKGLGLYPALFDAKKQA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatctagcgtttaccaatcaaaagcctcggacagtaaaggcgtgataaactgg
tcagaagaagaaaatcaaatttgggcagcgttatacgcgaggcaacttccgttattgaaa
acccgggcctgcgcacaatatatggatgggttgtcgttactggcactgcctgatgatcgc
attcctcagctaccagatatcgataaagtattgttagcgcaaaccggctggaaaaccgcc
gaggttcccgcactcatcaactttggtgaattttttagattactagccaacaagcaattc
cctgttgcaaccttcattcgctcgaaagatgaatttgattatcttcaagagccggatatt
tttcatgaggttttcggtcattgtcctttgcttacgaacccagcctttgcgcacttcact
catacctacggaaaactcggtttagcggcgagcaaagaagaccgaatctatctagcacga
ctttattggttcacggttgagtttgggctagttcgaagtcaagcgaatccagaaaagctg
gaaatttatggcggtggtatattgtcttccccgggtgaaacgctttatgcattagacagc
cacgaggcaattagaaaaccgcttacagcgacagatgcgctacgaactccatacagaatt
gatatcatgcagcccttgtattatgtacttccagacttcgattatctgttcgagttggct
gatatggatatcatgagcctagtgaataaagcgaaagggctcgggctatatccggcctta
ttcgacgccaaaaagcaggcttaa

DBGET integrated database retrieval system