KEGG   Anaplasma marginale St. Maries: AM032Help
Entry
AM032             CDS       T00216                                 

Gene name
orfY
Definition
(GenBank) ORF Y
Organism
ama  Anaplasma marginale St. Maries
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbC
Motif
Other DBs
NCBI-ProteinID: AAV86213
Position
complement(23955..24188)
Genome map
AA seq 77 aa AA seqDB search
MVALIWLFITAGSTNADTISSTNTADDTATKVICDVIVFVQKLGLPIMTGVVLGSGVMAW
HTCMACHGNAGCVYSHR
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atggtagccctgatatggttattcatcacagcaggttctactaatgccgatactatcagc
agtactaacactgctgacgatacagctaccaaggttatttgtgacgtcattgtcttcgtg
cagaagctgggattacccatcatgacaggggtggtactaggttctggcgtcatggcttgg
cacacttgcatggcctgccatggtaatgctggttgtgtgtacagccataggtaa

DBGET integrated database retrieval system