KEGG   Anaplasma marginale St. Maries: AM065Help
Entry
AM065             CDS       T00216                                 

Gene name
orfX
Definition
(GenBank) ORF X
Organism
ama  Anaplasma marginale St. Maries
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbC DUF2706
Motif
Other DBs
NCBI-ProteinID: AAV86233
Position
48140..48535
Genome map
AA seq 131 aa AA seqDB search
MLLKLRFLLIAVVLALGILHGVPAAGATGAQASPSPSTEADDTATVVICNVIRFVQKLGL
PIMTGVILGSSIMAIFGKLAWPAIVMLVVFTAIFFGAGKLMAKFAAGLSGEGVKDADKFD
CASHTGQGGRT
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgttgctaaaacttagattcttactcattgctgtagtattagcattgggtatcttacat
ggtgtacctgctgcaggggctactggtgctcaggcgagccctagtcccagtactgaagct
gatgatacagcgactgttgttatatgtaacgttatacggtttgtgcagaagctgggacta
cctatcatgactggggtgatattgggttctagcattatggccatctttggtaagcttgca
tggcctgctattgtgatgttggttgtatttacagcgatattctttggtgctggtaagctt
atggctaaatttgctgccggacttagtggtgaaggtgtgaaggatgccgataagtttgac
tgtgccagtcatactgggcaaggaggccggacttag

DBGET integrated database retrieval system