KEGG   Anaplasma marginale St. Maries: AM1059Help
Entry
AM1059            CDS       T00216                                 

Gene name
orfY
Definition
(GenBank) ORF Y
Organism
ama  Anaplasma marginale St. Maries
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbC
Motif
Other DBs
NCBI-ProteinID: AAV86925
Position
962297..962566
Genome map
AA seq 89 aa AA seqDB search
MFNFARRYLAPAMVALIWLFITAGSTNADTISSTNTADDTATKVICDVIVFVQKLGLPIM
TGVVLGSGVMAWHTCMACYCNAGCVYSHR
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgttcaactttgcacgaagatacctagctcctgctatggtagccctgatatggttattc
atcacagcaggttctactaatgccgatactatcagcagtactaacactgctgacgataca
gctaccaaggttatttgtgacgtcattgtcttcgtgcagaagctgggattacccatcatg
acaggggtggtactaggttctggcgtcatggcttggcacacttgcatggcctgctattgt
aatgctggttgtgtgtacagccataggtaa

DBGET integrated database retrieval system