KEGG   Anaplasma marginale St. Maries: AM1149Help
Entry
AM1149            CDS       T00216                                 

Gene name
orfX
Definition
(GenBank) ORF X
Organism
ama  Anaplasma marginale St. Maries
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbC
Motif
Other DBs
NCBI-ProteinID: AAV86993
Position
complement(1034507..1034896)
Genome map
AA seq 129 aa AA seqDB search
MLLKLRFLLIAVVLALGILHGVPAGAENVQAGQAAKDDDTATVVICNVIRFVQKLGLPIM
TGVILGSSIMAIFGKLAWPAIVMLVVFTAIFFGAGKLMAKFAAGLSGEGVKDAGSFDCSS
YKGTAQSNR
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgttgctaaaacttagattcttactcattgctgtagtattagcattgggtatcttacat
ggtgtacctgcaggggctgagaatgttcaggctggtcaggctgctaaggatgatgacaca
gcaaccgttgttatatgcaatgttatacggtttgtgcagaagctgggactacccatcatg
actggagtgatactaggttctagcattatggctatctttggtaagcttgcatggcctgct
attgtaatgctggttgtatttacagctatattctttggtgctggtaagcttatggctaaa
tttgctgctgggttgagtggtgagggtgtgaaggatgccggtagctttgactgttccagt
tataaaggcactgcccaaagtaaccgatag

DBGET integrated database retrieval system