KEGG   Anaplasma marginale St. Maries: AM179Help
Entry
AM179             CDS       T00216                                 

Gene name
folD
Definition
(GenBank) methylenetetrahydrofolate dehydrogenase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
ama  Anaplasma marginale St. Maries
Pathway
ama00670  One carbon pool by folate
ama01100  Metabolic pathways
ama01120  Microbial metabolism in diverse environments
ama01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ama00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AM179 (folD)
Enzymes [BR:ama01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     AM179 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     AM179 (folD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH OCD_Mu_crystall
Motif
Other DBs
NCBI-ProteinID: AAV86313
UniProt: Q5PBL6
Position
152987..153886
Genome map
AA seq 299 aa AA seqDB search
MREIIDGKLVARGLLDRLRVSVDRLKAEHGIVPHLVVVIVGDDPASKLYVGNKQRKAEEL
GLQSRTIALEHDTSQEELLRIIDELNRDAAVHGILVQLPLPRHIDKELVINAISPEKDVD
GFHNANAGKLATGQLDCMIPCTPQGCIHLIKTVKQDLAGSNAVVVGRSNIVGKPVALLLL
YENCTVTVLHSASRNLEEHCLRADIIVAAVGKARFIRASWIKPGAIVVDVGINLVEESGK
KRFVGDVEFEGLQDVPCSVTPVPGGVGPMTIAFLLVNTVLGSCKQCGVSYEDIKSSLLQ
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgaaataatagacggtaaactggttgcacggggtttgctagacaggttgcgtgta
tctgttgatcgacttaaggcagaacatggaatagtaccacacttggtggtggtcattgtt
ggggatgatccggcgagtaagctgtacgtaggcaataagcagcgcaaggcagaggagctc
ggcctgcagtcccggactattgcccttgagcatgatacctcccaggaggagctgttgcgc
atcattgatgagctaaacagagacgcggcagtgcacggtattttggtgcagctgccccta
ccaaggcatatagataaagagctggtgattaacgccatcagccccgagaaagacgttgat
gggtttcacaatgccaacgctggcaagctagccactggtcagctggattgcatgattcca
tgtactccgcaggggtgcatccatctgataaaaactgtaaaacaagatctggccggtagc
aacgcggtggttgtaggccgctctaacatagtgggaaagccagttgcattgctgctcctc
tacgaaaattgtacggtgactgtgctacactctgccagccgtaatcttgaagagcattgt
ttgcgggcagatataattgtggcagcggtgggcaaggcccgcttcattagggcttcctgg
atcaagcctggggcaatagttgtcgatgttggcataaaccttgtagaagagagcggcaag
aagcgctttgttggggatgttgagttcgaaggtttgcaggatgttccatgttcagtcact
ccggttcccgggggcgtggggccgatgaccatagcgttccttctggtgaacacggtttta
gggtcgtgcaagcaatgtggcgtttcttatgaagatataaaaagttctctgttgcagtag

DBGET integrated database retrieval system