KEGG   Anaplasma marginale St. Maries: AM203Help
Entry
AM203             CDS       T00216                                 

Gene name
gshB
Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
ama  Anaplasma marginale St. Maries
Pathway
ama00270  Cysteine and methionine metabolism
ama00480  Glutathione metabolism
ama01100  Metabolic pathways
Module
ama_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:ama00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AM203 (gshB)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AM203 (gshB)
Enzymes [BR:ama01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     AM203 (gshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AAV86326
Position
170965..171891
Genome map
AA seq 308 aa AA seqDB search
MLKVAFQMDEDVVVGRDVSVKLIEEAQRRGHEVFFYRPTSLAFVCGELVAEAFSVRVGAD
LLHFHDKTRLPLGKLDMLFVRQNPPFDMRYVTTTYLLERLDILMINNPKAIRDHPEKLLP
LSFPKFIPPTLITESVSEISAFYAEYGDIVLKPLYDYGGNGVCRICGRADVGAISSAMVE
RYEAPLVAQQFIDDISSDKRVVLLGGKPIGAVRRKVTAMGEIRTNLRVGATPEATELSDR
EREICHDVGTLLSSVGILFAGIDILGGRLIEVNVTSPCGILEINQVYGKTLERDCWDHFE
YVLSHKSP
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgctcaaagttgccttccagatggatgaagacgtcgtagttgggcgtgatgtttcagta
aaacttatagaagaggcccaacgtcgtgggcacgaggtgtttttttaccggccaaccagc
ctcgcatttgtgtgtggggagttggtcgccgaggcgttttctgtccgcgtgggtgcggat
ttgttacattttcatgacaaaactaggcttccgctggggaagctggacatgctatttgtg
cggcaaaacccccctttcgatatgcgatacgtgaccacaacttacttgcttgagcggctg
gatatcctcatgatcaacaatcctaaggcgattagggaccacccggaaaagctactgccg
ctgtcatttcctaagtttattcccccaaccttaatcaccgaaagtgtgagtgagataagt
gctttctacgcagagtacggagatatagtgctcaagccactgtacgattatggaggcaat
ggtgtatgcagaatctgcggcagggctgatgttggcgcaatatcgtcggcgatggttgag
cgttacgaagcacccttggttgcgcagcagtttattgatgacataagcagcgacaagcgg
gtagtgttgttgggcggcaaacccatcggggcggtacggcgaaaagttaccgctatgggt
gagatcagaaccaacctcagagtgggagcgacgcctgaggcaaccgagctttcggataga
gagcgtgaaatatgccacgatgtggggacgctactgtccagcgttggtatattgtttgct
ggaattgatattttaggaggccgccttatagaagtgaacgttacctcaccttgcggcatt
cttgagattaaccaagtgtacggaaagaccctagagagggattgctgggaccactttgaa
tacgtattgtcacataagtctccatga

DBGET integrated database retrieval system